Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13840 112 / 7e-30 FZR3 FIZZY-related 3 (.1.2) AT4G22910 89 / 1e-21 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT4G11920 74 / 2e-16 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT5G27945 59 / 3e-11 Transducin/WD40 repeat-like superfamily protein (.1) AT5G27570 57 / 2e-10 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27080 55 / 1e-09 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 55 / 1e-09 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT4G33270 55 / 1e-09 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT5G26900 52 / 2e-08 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040282 [exp] 118 / 1e-31 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2) Lus10001192 [exp] 80 / 3e-18 AT4G22910 734 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Lus10024482 [exp] 80 / 3e-18 AT4G22910 733 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Lus10023401 [exp] 69 / 3e-14 AT5G13840 546 / 0.0 FIZZY-related 3 (.1.2) Lus10043009 [exp] 57 / 4e-10 AT4G33270 344 / 1e-114 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 54 / 3e-09 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 53 / 6e-09 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 53 / 6e-09 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 52 / 1e-08 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G057500 [exp] 114 / 1e-30 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.010G202100 [exp] 113 / 2e-30 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.003G119500 [exp] 77 / 1e-17 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.001G112700 [exp] 77 / 4e-17 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.016G118400 [exp] 58 / 1e-10 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 56 / 4e-10 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 56 / 9e-10 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 54 / 2e-09 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 54 / 3e-09 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10002972 pacid=23142142 polypeptide=Lus10002972 locus=Lus10002972.g ID=Lus10002972.BGIv1.0 annot-version=v1.0 ATGAAAAAGATGAAGATGAAAACATTGATTTCCAAGTCTTCGCCGGAGAAGGAGGAAGTGCAGCTGCCGCAACCTGCGTTGAGTGTGAACAGAATTCGCA ACCGACCGAAACCGCAGGTACGAGGAACTGGAATCCTACCAAGAGGAATGCACCATGGTAAGAGTGTTCTGGCATGGAATTCTACAGTTCTGGCACCAGG AGACAGGTACAGGAACATACTTCGGCATGATCTTCGTCTCCCGAGTGACTACGTTAGGAAGCTTGTTGGTCATAAATCTGAGATATATCGGCTAAAATGG TCACATGATGACAGAGAGCTTGCATCTGGTGGAAACGAAAATCAGCTGATTCTCAAGCTCACAGAGCCCACGGCTGCAGTGAAGCCGATTGCATGA
AA sequence Show only first row Show all	>Lus10002972 pacid=23142142 polypeptide=Lus10002972 locus=Lus10002972.g ID=Lus10002972.BGIv1.0 annot-version=v1.0 MKKMKMKTLISKSSPEKEEVQLPQPALSVNRIRNRPKPQVRGTGILPRGMHHGKSVLAWNSTVLAPGDRYRNILRHDLRLPSDYVRKLVGHKSEIYRLKW SHDDRELASGGNENQLILKLTEPTAAVKPIA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G13840		FZR3	FIZZY-related 3 (.1.2)		Lus10002972 [exp]	0	1
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	1.7	1.0000
AT5G12460			Protein of unknown function (D...		Lus10003179 [exp]	2.0	1.0000
					Lus10003763 [exp]	2.4	1.0000
AT2G23810		TET8	tetraspanin8 (.1)		Lus10027256 [exp]	3.2	1.0000
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10028664 [exp]	3.5	1.0000
					Lus10034359 [exp]	3.7	1.0000
AT5G64820			unknown protein		Lus10025572 [exp]	4.5	1.0000
AT2G41970			Protein kinase superfamily pro...		Lus10016247 [exp]	4.7	1.0000
					Lus10035743 [exp]	5.1	1.0000
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10037113 [exp]	5.3	1.0000

Compare expression of checked genes

Lus10002972 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.