Lus10002983 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17260 151 / 2e-45 Lactate/malate dehydrogenase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004350 237 / 5e-79 AT4G17260 550 / 0.0 Lactate/malate dehydrogenase family protein (.1)
Lus10028931 153 / 6e-49 AT4G17260 88 / 1e-21 Lactate/malate dehydrogenase family protein (.1)
Lus10006030 103 / 6e-27 AT4G17260 124 / 9e-32 Lactate/malate dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G122400 171 / 4e-53 AT4G17260 545 / 0.0 Lactate/malate dehydrogenase family protein (.1)
Potri.008G135920 164 / 7e-52 AT4G17260 372 / 1e-130 Lactate/malate dehydrogenase family protein (.1)
Potri.003G111201 76 / 4e-17 AT4G17260 477 / 3e-171 Lactate/malate dehydrogenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
Representative CDS sequence
>Lus10002983 pacid=23176898 polypeptide=Lus10002983 locus=Lus10002983.g ID=Lus10002983.BGIv1.0 annot-version=v1.0
ATGCACAATACGCCTTCAGGTTCAGTACTGGGCGGCCCCGACGACCTAGACATAACCCAAACATTTTTCAAACCCATCCAGAGAACCGACTCGCTCTACT
CATCCAAGCGCTACATCACCAAGATCTCTGTCATCGGCGTCGGAAACGTTGGCATGGCCATCGCCCAGACCATCCTCACCCAGGAACTCGCCGACGAGAT
CGCCCTTGTCGACGCTAACCACGACAAGCTTCGCGGCGAGATGCTTGACCTCCAGCACGCCGCCGCATTTCCCCCACGCACCAAGATCCTCACCACCACC
GACTCCTCCGTCACCGCCGGATCCGACCTCTGCATCGTCACCGCCGGCGCCCGCCAGAACCCTGGCGAGTCCAGGCTCAACCTCCTCAGCGAAACATCAC
CATCTTCAAGTCGATCATCCCTTTCTTAG
AA sequence
>Lus10002983 pacid=23176898 polypeptide=Lus10002983 locus=Lus10002983.g ID=Lus10002983.BGIv1.0 annot-version=v1.0
MHNTPSGSVLGGPDDLDITQTFFKPIQRTDSLYSSKRYITKISVIGVGNVGMAIAQTILTQELADEIALVDANHDKLRGEMLDLQHAAAFPPRTKILTTT
DSSVTAGSDLCIVTAGARQNPGESRLNLLSETSPSSSRSSLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17260 Lactate/malate dehydrogenase f... Lus10002983 0 1
AT4G17260 Lactate/malate dehydrogenase f... Lus10002982 3.6 0.8485
AT1G14220 Ribonuclease T2 family protein... Lus10035882 21.5 0.7475
AT2G02990 RNS1, ATRNS1 ribonuclease 1 (.1) Lus10035881 30.8 0.7400
Lus10037168 32.2 0.7619
Lus10006216 42.8 0.7429
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10030078 80.4 0.7137
AT3G12960 unknown protein Lus10011871 111.9 0.6851
Lus10029831 120.6 0.7051
AT1G49570 Peroxidase superfamily protein... Lus10023858 193.5 0.6769
AT1G60420 DC1 domain-containing protein ... Lus10029148 223.9 0.6749

Lus10002983 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.