Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40080 147 / 5e-48 Mitochondrial ribosomal protein L27 (.1) AT4G09012 139 / 2e-43 Mitochondrial ribosomal protein L27 (.1) AT5G39800 132 / 9e-42 Mitochondrial ribosomal protein L27 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011032 [exp] 186 / 4e-63 AT5G40080 146 / 2e-47 Mitochondrial ribosomal protein L27 (.1) Lus10034241 [exp] 172 / 1e-57 AT5G40080 137 / 5e-44 Mitochondrial ribosomal protein L27 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G161600 [exp] 171 / 2e-57 AT5G40080 144 / 8e-47 Mitochondrial ribosomal protein L27 (.1) Potri.006G070700 [exp] 171 / 4e-57 AT5G40080 150 / 4e-49 Mitochondrial ribosomal protein L27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09809 [flax] [poplar] MRP-L27 Mitochondrial ribosomal protein L27
Representative CDS sequence Show only first row Show all	>Lus10003002 pacid=23176151 polypeptide=Lus10003002 locus=Lus10003002.g ID=Lus10003002.BGIv1.0 annot-version=v1.0 ATGCCTCTGGGTTTGATAGCTGGGATTGCTAGGGCGATGAGGAGGAAGAGGACTTCGTCGCTGGATATTCTGTCGTCCAAGCGAGCTCCTCGCAATTTCT ACAAGGGAAAGAACTGCAAACCCACTGGTTTCCATACCCGCAAAGGTGGTTACGTCATCGTGCCTGAGAAGTTGCCCAACTACGTAGTTCCTGATTTGAC CAACTTCATGCTCAAACCATATGTATCTCAGTGCCCAGTCGAAGTTAAGACAACTGAAGCTTCTGTAGCAGCCTAA
AA sequence Show only first row Show all	>Lus10003002 pacid=23176151 polypeptide=Lus10003002 locus=Lus10003002.g ID=Lus10003002.BGIv1.0 annot-version=v1.0 MPLGLIAGIARAMRRKRTSSLDILSSKRAPRNFYKGKNCKPTGFHTRKGGYVIVPEKLPNYVVPDLTNFMLKPYVSQCPVEVKTTEASVAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40080			Mitochondrial ribosomal protei...		Lus10003002 [exp]	0	1
AT5G56710			Ribosomal protein L31e family ...		Lus10037703 [exp]	2.8	0.9340
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	4.2	0.9230
AT5G11390		WIT1	WPP domain-interacting protein...		Lus10005102 [exp]	4.7	0.9045
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	6.0	0.9148
AT5G50810		TIM8	translocase inner membrane sub...		Lus10022450 [exp]	6.0	0.9145
AT3G01435			Expressed protein (.1)		Lus10022634 [exp]	8.3	0.8520
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10038878 [exp]	12.4	0.8802
AT3G18760			Translation elongation factor...		Lus10006729 [exp]	14.1	0.8789
AT1G41880			Ribosomal protein L35Ae family...		Lus10028254 [exp]	15.7	0.9108
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	17.9	0.8929

Compare expression of checked genes

Lus10003002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.