Lus10003004 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35190 358 / 5e-126 NSPN11, ATNPSN11, NPSN11 novel plant snare 11 (.1)
AT3G17440 288 / 2e-98 ATNPSN13, NPSN13 novel plant snare 13 (.1.2)
AT1G48240 283 / 4e-96 ATNPSN12 novel plant snare 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011034 374 / 2e-132 AT2G35190 274 / 2e-93 novel plant snare 11 (.1)
Lus10017116 278 / 7e-94 AT3G17440 410 / 6e-146 novel plant snare 13 (.1.2)
Lus10018338 277 / 8e-93 AT3G17440 375 / 2e-131 novel plant snare 13 (.1.2)
Lus10000163 59 / 2e-11 AT3G17440 103 / 3e-29 novel plant snare 13 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G085200 384 / 3e-136 AT2G35190 391 / 6e-139 novel plant snare 11 (.1)
Potri.001G149200 380 / 8e-135 AT2G35190 389 / 4e-138 novel plant snare 11 (.1)
Potri.010G001900 288 / 4e-98 AT3G17440 429 / 8e-154 novel plant snare 13 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0147 Traffic PF03908 Sec20 Sec20
Representative CDS sequence
>Lus10003004 pacid=23176159 polypeptide=Lus10003004 locus=Lus10003004.g ID=Lus10003004.BGIv1.0 annot-version=v1.0
ATGGATGATTTATCGCATATCAGTGAAGAAGTAGCTGAAATTGATGGACAAATTGCAGATATCTTTCGAGCCTTATCGAATGGGTTTCAAAAACTGGAAA
AGGTTAAAGATGCCAACAGAAGAAGCAGACAATTGGAAGAGCTTACAGACAAAATGAGAGAATGTAAAAGGCTTATCAAAGAATTTGACAAAGAAGTGAA
GAACCTTGAAAGGAGAAATGATGCTATGATAAATAGAACCCTAAATGAGAAGAAGCAATCAATGATAAAAGAGTTGAATTCTTATGTTGCATTAAAGAAG
CAATATGCAGTAAATGTTGACAAGAAGAGAGTTGATCTATTTGATGGGCCAAGTGAGGGGTTTCATGATGATAATGTTATGTTAGCTTCATCAATGACAA
ATGAACAATTGATGGACCATGGCAATCACATGATGGATGAGACTGATGATGCACTTGAAAGGGGCAAAAAGATTGTTCAAGAAACTATCGATGTCGGGAC
AGAGACCGCAACCAGTCTCAAGACTCAAACAGAACAAATGAGCAGGGTAGTTAATGAGTTAGACTCGATCCACTTCTCGATGAAGAGGGCTTCTAAATTA
GCGAAGGAAATTGGTAGACAATTTGCAACTGACAAGATGATTATGACAATGCTTTTCCTCATCGTCATTGGAATTGTCACAATCTTCATTATTAAGCTCG
TCAATCCAAATAACAAAACCATTCAAGACATTTCCGGGCTAGCTCCACCAGCAATGGCTCGCAAGCTACTCTGGCATAGTCACTGA
AA sequence
>Lus10003004 pacid=23176159 polypeptide=Lus10003004 locus=Lus10003004.g ID=Lus10003004.BGIv1.0 annot-version=v1.0
MDDLSHISEEVAEIDGQIADIFRALSNGFQKLEKVKDANRRSRQLEELTDKMRECKRLIKEFDKEVKNLERRNDAMINRTLNEKKQSMIKELNSYVALKK
QYAVNVDKKRVDLFDGPSEGFHDDNVMLASSMTNEQLMDHGNHMMDETDDALERGKKIVQETIDVGTETATSLKTQTEQMSRVVNELDSIHFSMKRASKL
AKEIGRQFATDKMIMTMLFLIVIGIVTIFIIKLVNPNNKTIQDISGLAPPAMARKLLWHSH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G35190 NSPN11, ATNPSN1... novel plant snare 11 (.1) Lus10003004 0 1
Lus10032968 6.9 0.9990
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027891 9.8 0.9983
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10014217 12.0 0.9983
AT5G66740 Protein of unknown function (D... Lus10026031 13.3 0.9505
AT5G53130 ATCNGC1, CNGC1 CYCLIC NUCLEOTIDE-GATED CHANNE... Lus10003396 13.4 0.9461
AT5G14760 AO L-aspartate oxidase (.1) Lus10018901 13.9 0.9983
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10003942 13.9 0.9203
AT4G16730 AtTPS02 terpene synthase 02 (.1) Lus10006357 14.4 0.9746
AT3G16857 GARP ARR1 response regulator 1 (.1.2) Lus10039345 15.5 0.9983
AT3G15270 SBP SPL5 squamosa promoter binding prot... Lus10005548 15.7 0.9387

Lus10003004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.