Plant FIBer expression Database

Lus10003019 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46920 149 / 6e-43 Intron maturase, type II family protein (.1)
AT1G30010 98 / 1e-24 Intron maturase, type II family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011050
[exp]
248 / 2e-79 AT5G46920 1110 / 0.0 Intron maturase, type II family protein (.1)
Lus10028124
[exp]
94 / 2e-23 AT1G30010 1011 / 0.0 Intron maturase, type II family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G086801
[exp]
163 / 7e-48 AT5G46920 1150 / 0.0 Intron maturase, type II family protein (.1)
Potri.001G147801
[exp]
155 / 3e-45 AT5G46920 1140 / 0.0 Intron maturase, type II family protein (.1)
Potri.004G132450
[exp]
102 / 5e-26 AT1G30010 988 / 0.0 Intron maturase, type II family protein (.1)
PFAM info
Representative CDS sequence
>Lus10003019 pacid=23176148 polypeptide=Lus10003019 locus=Lus10003019.g ID=Lus10003019.BGIv1.0 annot-version=v1.0
ATGGGGCTTGTGGAGTCGATTGATGGACTCCAGTACACCAGGATGTCTCTTGTCCCCGAAACGGATTACTCTCCGTTCCCGAATAACTGGAGGCCTGATC
ACGAGAAAGCATTGATCGAGTACATAAACCTCGAGGATCCAAAAAGATTAGAGGAGCAGCAGTCTGTTATTAGAGATCAAGGTCTGGTATCTCCTCAGGA
TTACATCTCGATGCTTGTGTGGAATTACAAGAGAAATGCACTTGCTATGGATCAGTATCCGAATTTATCGAGAGGGATCAGCACGGAAAAAGAGGCGAAT
TCGAATGTTCTGTTGTTGTCTGAGAACCATGGCCAGCAGAGAAGGTCGGAAGATGAAGAGCACGGTGCTAGATCCGTTGCCGCCCAAATGTAA
AA sequence
>Lus10003019 pacid=23176148 polypeptide=Lus10003019 locus=Lus10003019.g ID=Lus10003019.BGIv1.0 annot-version=v1.0
MGLVESIDGLQYTRMSLVPETDYSPFPNNWRPDHEKALIEYINLEDPKRLEEQQSVIRDQGLVSPQDYISMLVWNYKRNALAMDQYPNLSRGISTEKEAN
SNVLLLSENHGQQRRSEDEEHGARSVAAQM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46920 Intron maturase, type II famil... Lus10003019
[exp]
0 1
AT1G22950 2-oxoglutarate (2OG) and Fe(II... Lus10000171
[exp]
1.4 0.8132
AT3G59650 mitochondrial ribosomal protei... Lus10006114
[exp]
2.2 0.8573
AT1G23890 NHL domain-containing protein ... Lus10030849
[exp]
2.6 0.7791
AT5G37820 NIP4;2, NLM5 NODULIN- 26-LIKE MAJOR INTRINS... Lus10028520
[exp]
2.8 0.7786
AT2G33845 Nucleic acid-binding, OB-fold-... Lus10015411
[exp]
6.2 0.8042
AT3G12390 Nascent polypeptide-associated... Lus10026133
[exp]
6.9 0.7971
AT3G07640 unknown protein Lus10041098
[exp]
8.4 0.7696
AT4G01260 GeBP DNA-binding storekeeper protei... Lus10004772
[exp]
9.2 0.7817
AT1G32730 unknown protein Lus10001085
[exp]
9.2 0.7851
AT1G73450 Protein kinase superfamily pro... Lus10031328
[exp]
11.0 0.7678

Lus10003019 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.