Lus10003022 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13870 502 / 0 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 484 / 2e-174 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT4G14130 308 / 4e-105 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 307 / 1e-104 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G65730 306 / 2e-104 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G03210 296 / 3e-100 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT4G37800 294 / 1e-99 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT5G57550 293 / 4e-99 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT1G11545 288 / 3e-97 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
AT5G57560 285 / 3e-96 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011052 596 / 0 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10040121 520 / 0 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 517 / 0 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039715 324 / 3e-111 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10018503 319 / 2e-109 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10031586 310 / 7e-106 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10039643 304 / 1e-103 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10011597 303 / 5e-103 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10010938 300 / 4e-102 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G071000 519 / 0 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.003G159700 508 / 0 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 499 / 2e-180 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.007G008500 314 / 2e-107 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.002G060500 311 / 2e-106 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 311 / 3e-106 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.019G125000 310 / 6e-106 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.005G201200 308 / 5e-105 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 308 / 6e-105 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.013G152400 308 / 6e-105 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10003022 pacid=23176152 polypeptide=Lus10003022 locus=Lus10003022.g ID=Lus10003022.BGIv1.0 annot-version=v1.0
ATGGCTGCTTCTGCAATTGCTCTGTTTCTCCTCATTTCCGTCTTCTTTGCCGGAGCAATGGCTGCTCCACCGAAGAAGGCGGTGAACGTCCCCTTCGGAA
GGAACTACGCTCCCACGTGGGCTTTCGACCACATCAAGCAGTTCAATGGCGGTAACGAGATCCAGCTCCACCTCGATAACTACACAGGGACGGGGTTTCA
GTCGAAGGGGTCGTACTTGTTCGGCCACTTTAGTATGCATATCAAGATGGTTGGTGGAGACTCTGCCGGGACCGTCACTGCTTTCTATCTATCGTCCCAA
AACTCGGAGCACGACGAGATCGACTTCGAGTTCTTGGGGAACAGAACAGGACAACCTTACATCCTCCAAACGAATGTGTTCACCGGTGGCAAGGGCGATC
GGGAGCAGAGGATCTACCTCTGGTTCGACCCGACGAAAGACTACCACTCGTACTCGGTCCTCTGGAACAGCTACCTTATTGCGTTCTTCGTTGATGACGT
CCCGATCCGAGTATTCAGGAACCTGAAGAACCTAGGAGTGAAGTTCCCCTTCCAGCAGCCGATGAAGATCTACTCCAGCCTGTGGAACGCCGACGACTGG
GCGACGAGGGGCGGCCTGGAGAAGACTGACTGGTCCAAGGCGCCATTCGTCGCCGCCTACAAGGGCTTCCACATCGACGGTTGCGAGGCGTCAGTGAATG
CCAAGTTTTGCGCCACTCAGGGAAAGAGGTGGTGGGATCAGAAGGAGTTCCAGGACATGGATGCTCAGCAGTACCGCCGGATCCGGTGGGTCCGAAAGAA
GTACACCATTTACAACTACTGCACCGACCGGGTCCGGTACCCTAAGATGCCCTCGGAGTGCAAGCCCGATCGTGACGTTATGGGTCGTGGGAGAGTTTGA
AA sequence
>Lus10003022 pacid=23176152 polypeptide=Lus10003022 locus=Lus10003022.g ID=Lus10003022.BGIv1.0 annot-version=v1.0
MAASAIALFLLISVFFAGAMAAPPKKAVNVPFGRNYAPTWAFDHIKQFNGGNEIQLHLDNYTGTGFQSKGSYLFGHFSMHIKMVGGDSAGTVTAFYLSSQ
NSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKDYHSYSVLWNSYLIAFFVDDVPIRVFRNLKNLGVKFPFQQPMKIYSSLWNADDW
ATRGGLEKTDWSKAPFVAAYKGFHIDGCEASVNAKFCATQGKRWWDQKEFQDMDAQQYRRIRWVRKKYTIYNYCTDRVRYPKMPSECKPDRDVMGRGRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10003022 0 1
AT1G62770 Plant invertase/pectin methyle... Lus10032230 1.4 0.9786
AT4G35200 Arabidopsis protein of unknown... Lus10022635 2.8 0.9567
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10011052 4.0 0.9723
AT5G24070 Peroxidase superfamily protein... Lus10025586 5.0 0.9557
AT4G32060 calcium-binding EF hand family... Lus10041027 5.5 0.9320
AT1G62770 Plant invertase/pectin methyle... Lus10024593 7.1 0.9315
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Lus10006199 7.7 0.9407
AT1G06930 unknown protein Lus10024185 8.1 0.9569
AT4G35200 Arabidopsis protein of unknown... Lus10003332 8.8 0.9420
AT4G32690 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemo... Lus10022120 11.2 0.9371

Lus10003022 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.