Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47890 155 / 4e-51 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011053 [exp] 197 / 3e-67 AT5G47890 155 / 4e-51 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Lus10040122 [exp] 169 / 3e-56 AT5G47890 150 / 8e-49 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Lus10030922 [exp] 167 / 1e-55 AT5G47890 149 / 2e-48 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G071900 [exp] 161 / 3e-53 AT5G47890 145 / 8e-47 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Potri.003G159100 [exp] 152 / 8e-50 AT5G47890 152 / 1e-49 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Potri.013G126200 [exp] 40 / 3e-05 AT3G59650 202 / 8e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF05047 [flax] [poplar] L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Representative CDS sequence Show only first row Show all	>Lus10003023 pacid=23176156 polypeptide=Lus10003023 locus=Lus10003023.g ID=Lus10003023.BGIv1.0 annot-version=v1.0 ATGGCGTGGAGAGGCCAGTTATCTAAGAATCTGAAGGAGCTACGTGTCCTTCTGTGCCAGTCTTCTCCTGCAAGCTCCTCCACCAGAGCTTTCGTAGAGA AGAATTACAAGGATCTGAAGACGCTTAATCCCAAGCTCCCCATCTTGATCCGCGAGTGCAGTGGGATCGAGCCGCAGCTGTGGGCTAGATACGATATGGG CGTGGAGAGGGGTGTCCGCTTGGAAGGGAAAGACGAGGGACAGATCGAGAAGGCATTGGAAGAGCTTGTCAAAGTAGGTGCAGCCCTCACGGCATGA
AA sequence Show only first row Show all	>Lus10003023 pacid=23176156 polypeptide=Lus10003023 locus=Lus10003023.g ID=Lus10003023.BGIv1.0 annot-version=v1.0 MAWRGQLSKNLKELRVLLCQSSPASSSTRAFVEKNYKDLKTLNPKLPILIRECSGIEPQLWARYDMGVERGVRLEGKDEGQIEKALEELVKVGAALTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10003023 [exp]	0	1
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10023428 [exp]	1.7	0.8842
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10040307 [exp]	3.7	0.8625
AT4G40060	HD	ATHB16 ,ATHB-16	homeobox protein 16 (.1)		Lus10012753 [exp]	4.5	0.8087
AT1G50740			Transmembrane proteins 14C (.1...		Lus10019624 [exp]	5.0	0.8277
AT4G28240			Wound-responsive family protei...		Lus10018535 [exp]	6.0	0.8143
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	7.5	0.8249
AT1G56423			unknown protein		Lus10029844 [exp]	7.9	0.8562
AT2G25720			unknown protein		Lus10042976 [exp]	8.5	0.7873
AT3G58630	Trihelix		sequence-specific DNA binding ...		Lus10015281 [exp]	13.8	0.7854
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	14.5	0.7913

Compare expression of checked genes

Lus10003023 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.