Lus10003030 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017800 125 / 3e-37 ND /
Lus10007779 95 / 7e-25 ND /
Lus10014851 98 / 4e-24 ND 34 / 0.005
Lus10042979 98 / 6e-24 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Lus10026444 94 / 1e-22 ND /
Lus10029489 70 / 4e-15 ND /
Lus10006886 67 / 3e-13 ND /
Lus10027613 65 / 1e-12 ND /
Lus10007415 64 / 4e-12 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003030 pacid=23180827 polypeptide=Lus10003030 locus=Lus10003030.g ID=Lus10003030.BGIv1.0 annot-version=v1.0
ATGAACTCATCCTCCTCCTCCTTTGCTGCTGGAGTCATGGTCGGGACGGTGATGGTGGAGATCGCTATGGACGCGGCCCCGCGAGAGGAGGCCACTGTGG
TTCTTGTGCTTGGCGGCGACGGTGGTTGCCGAAACGGAAGGAGCGAATGTGGTGGTGGTGATGGTTGTGGCGTCGAGGGTGTGGCAGTGGATGTAGCTGT
GATTTGCTTGGAGCCGTCGTGGGTATTTAGGTGGGAAGCCATTGGTGGCTACATCAAACTTCTCTCAATCGAGAGCTACTCAGTCCTCGCGCGGTGTGCG
GATGCAACAACAACAACTGACATCTTATTCACCGGAACATCAGCATCCCTTCTGTTACGCATGCCTCCAGATGAATACGTGACCCTGACTCATCAACAAG
AAACTACACTTCTGCTTGGACTGCACGACACCATGTTTGTTCTCGAGGTTTGCCCTGTCGATCCTGGTCACATCGACCAAGCAAAGTTTGTCGCTACTAA
TCTTTGGGATCCCGTTGTTGCTTTCTACTAG
AA sequence
>Lus10003030 pacid=23180827 polypeptide=Lus10003030 locus=Lus10003030.g ID=Lus10003030.BGIv1.0 annot-version=v1.0
MNSSSSSFAAGVMVGTVMVEIAMDAAPREEATVVLVLGGDGGCRNGRSECGGGDGCGVEGVAVDVAVICLEPSWVFRWEAIGGYIKLLSIESYSVLARCA
DATTTTDILFTGTSASLLLRMPPDEYVTLTHQQETTLLLGLHDTMFVLEVCPVDPGHIDQAKFVATNLWDPVVAFY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003030 0 1
AT2G23570 ATMES19 ARABIDOPSIS THALIANA METHYL ES... Lus10000841 2.0 0.8274
AT3G02645 Plant protein of unknown funct... Lus10016396 3.6 0.8424
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10000381 4.0 0.8163
AT5G14240 Thioredoxin superfamily protei... Lus10014596 7.3 0.8089
AT1G07590 Tetratricopeptide repeat (TPR)... Lus10029724 10.8 0.8213
AT3G27220 Galactose oxidase/kelch repeat... Lus10014602 13.7 0.7929
AT1G18530 EF hand calcium-binding protei... Lus10027243 15.9 0.7405
AT4G14746 unknown protein Lus10025761 18.5 0.7191
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013333 19.2 0.7924
Lus10000350 20.0 0.6380

Lus10003030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.