Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38760 56 / 2e-12 Late embryogenesis abundant protein (LEA) family protein (.1) AT5G53820 49 / 1e-09 Late embryogenesis abundant protein (LEA) family protein (.1) AT3G02480 36 / 0.0001 Late embryogenesis abundant protein (LEA) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034100 [exp] 79 / 1e-21 AT5G38760 89 / 2e-25 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10027298 [exp] 54 / 1e-11 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10039004 [exp] 54 / 2e-11 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10010451 [exp] 53 / 4e-11 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034081 [exp] 51 / 1e-10 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10007566 [exp] 50 / 3e-10 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003056 [exp] 50 / 5e-10 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10012179 [exp] 46 / 2e-08 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10026292 [exp] 45 / 3e-08 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G107500 [exp] 60 / 5e-14 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107600 [exp] 56 / 2e-12 AT5G38760 90 / 8e-26 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107100 [exp] 56 / 3e-12 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107900 [exp] 56 / 3e-12 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107800 [exp] 56 / 3e-12 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108350 [exp] 56 / 3e-12 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108300 [exp] 56 / 3e-12 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108400 [exp] 55 / 6e-12 AT5G38760 97 / 2e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107700 [exp] 47 / 4e-09 AT5G53820 75 / 6e-20 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G106350 [exp] 40 / 5e-06 AT5G53820 42 / 9e-07 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003046 pacid=23154523 polypeptide=Lus10003046 locus=Lus10003046.g ID=Lus10003046.BGIv1.0 annot-version=v1.0 ATGGCGTACCACGCCGGAGAGGCGAAGGGGCAAGGGCAGGAGAAGGCGAGCGGGATGATGGACAAGGCGGCCGGAGCAGCTCAGTCGACTAAGGAATCGA TGCAGGATGCCGGGCAGCAGATGAAGGCTAAGGCACAGGGCGCTGCTGACGCCGTTAAGGATGCCACCGGCATGAACAAGTCCAACTGA
AA sequence Show only first row Show all	>Lus10003046 pacid=23154523 polypeptide=Lus10003046 locus=Lus10003046.g ID=Lus10003046.BGIv1.0 annot-version=v1.0 MAYHAGEAKGQGQEKASGMMDKAAGAAQSTKESMQDAGQQMKAKAQGAADAVKDATGMNKSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38760			Late embryogenesis abundant pr...		Lus10003046 [exp]	0	1
AT4G16850			unknown protein		Lus10015507 [exp]	2.8	0.9455
AT5G18170		GDH1	glutamate dehydrogenase 1 (.1)		Lus10005697 [exp]	3.2	0.9548
					Lus10031312 [exp]	3.7	0.9290
AT3G14260			Protein of unknown function (D...		Lus10001484 [exp]	7.5	0.9531
AT2G29350		SAG13	senescence-associated gene 13 ...		Lus10024358 [exp]	8.1	0.9297
AT4G21920			unknown protein		Lus10001143 [exp]	10.0	0.9398
AT2G23790			Protein of unknown function (D...		Lus10022496 [exp]	12.2	0.9386
AT4G27310	CO		B-box type zinc finger family ...		Lus10018513 [exp]	12.3	0.9243
AT4G37870		PCK1, PEPCK	phosphoenolpyruvate carboxykin...		Lus10028227 [exp]	12.7	0.9483
AT4G21510			F-box family protein (.1)		Lus10018432 [exp]	12.8	0.9012

Compare expression of checked genes

Lus10003046 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.