Lus10003048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 361 / 2e-126 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 355 / 8e-124 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 338 / 3e-117 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G30270 337 / 4e-117 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT4G25810 333 / 2e-115 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 333 / 4e-115 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57540 322 / 4e-111 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 320 / 4e-110 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT4G25820 319 / 1e-109 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT2G18800 299 / 1e-101 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034098 507 / 0 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 495 / 4e-179 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 491 / 1e-177 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 489 / 1e-176 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 487 / 5e-176 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 486 / 1e-175 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 409 / 3e-145 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 407 / 3e-144 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 406 / 5e-144 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 411 / 8e-146 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 408 / 9e-145 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 400 / 8e-142 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 382 / 1e-134 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G236200 368 / 4e-129 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.014G146100 367 / 1e-128 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 353 / 4e-123 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095100 345 / 8e-120 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 342 / 1e-118 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 339 / 5e-117 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10003048 pacid=23154515 polypeptide=Lus10003048 locus=Lus10003048.g ID=Lus10003048.BGIv1.0 annot-version=v1.0
ATGGCGGCAACTCTGCCTCTGGTGATGTTACTAGTGACGGTGTTGGGTACTCATCTAGTGCCAATCTCGAATGCCAACTTCCACCAGCATTTTGACGTCA
CTTGGGGGCACCACCATGCTCAGATCACCAACGGCGGACAGCAATTAGCCCTCTCCCTCAACAAGGATTCCGGCGCTGGCTTCAAATCCAAGAACGAGTA
TCTCTTTGGTCGCATCGATATGCAACTCAAGCTCATCGCTGGCAACTCTGCTGGAAGTGTCACGACTTTTTACCTGTCGTCGAAAGAAGGACCGAATCAC
GATGAAATCGACTTCGAGTTTCTCGGAAACTCCACCGGTAATCCTTACACGCTCCACACCAATGTTTTTAGTCAAGGAAAAGGCAACAGAGAACAACAGT
TCCATCTCTGGTTCGACCCGACTGCTGCTTTCCACACCTACACCATCCTTTGGAATTCCCAAAGAATCATATTCTTGGTGGACAACATACCAATCAGAGT
GTTCAACAACTTGGAATCAATGGGGGTTCCATTCCCGAACAAGAAGCCGATGAGCATCCACTCCAGCTTGTGGAATGCTGATGATTGGGCTACCCAAGGC
GGAAGAGTCAAGGCTGATTGGACCAACGCTCCATTCGTCGCGTCTTACAGAAACTTCAAGGCCGAAGCCTGCGTCTGGTCACCGTCCTCGGCCTCCTCAA
CCTGCTCTCCGGGAGGATGGCAGACTCAGGGGATTGATGCCGCCGGCCGGAACAGGATCCGATGGGTGCAGAGCAAATATATGATCTACAATTACTGCAC
CGACTTGCAACGCTTCCCTCAGGGCGTCCCTGTTGAATGCAAGCAGTCCCGATTCCTTTGA
AA sequence
>Lus10003048 pacid=23154515 polypeptide=Lus10003048 locus=Lus10003048.g ID=Lus10003048.BGIv1.0 annot-version=v1.0
MAATLPLVMLLVTVLGTHLVPISNANFHQHFDVTWGHHHAQITNGGQQLALSLNKDSGAGFKSKNEYLFGRIDMQLKLIAGNSAGSVTTFYLSSKEGPNH
DEIDFEFLGNSTGNPYTLHTNVFSQGKGNREQQFHLWFDPTAAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFPNKKPMSIHSSLWNADDWATQG
GRVKADWTNAPFVASYRNFKAEACVWSPSSASSTCSPGGWQTQGIDAAGRNRIRWVQSKYMIYNYCTDLQRFPQGVPVECKQSRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10003048 0 1
AT4G09600 GASA3 GAST1 protein homolog 3 (.1) Lus10025962 1.0 0.9573
AT4G11290 Peroxidase superfamily protein... Lus10028688 2.6 0.9065
AT2G03350 Protein of unknown function, D... Lus10037126 3.7 0.9431
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10009513 5.2 0.8982
AT5G35740 Carbohydrate-binding X8 domain... Lus10012324 5.3 0.9166
AT2G17080 Arabidopsis protein of unknown... Lus10014446 5.5 0.9164
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10008603 7.1 0.9358
AT5G19730 Pectin lyase-like superfamily ... Lus10041815 11.0 0.8932
AT3G02100 UDP-Glycosyltransferase superf... Lus10003453 12.4 0.8816
AT3G57040 ATRR4, ARR9 RESPONSE REGULATOR 4, response... Lus10039524 14.1 0.8743

Lus10003048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.