Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38710 62 / 1e-13 Methylenetetrahydrofolate reductase family protein (.1) AT3G30775 59 / 2e-12 PDH1, PRODH, PRO1, AT-POX, ATPOX, ATPDH, ERD5 proline dehydrogenase 1, EARLY RESPONSIVE TO DEHYDRATION 5, ARABIDOPSIS THALIANA PROLINE OXIDASE, Methylenetetrahydrofolate reductase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034094 [exp] 90 / 3e-23 AT5G38710 494 / 4e-172 Methylenetetrahydrofolate reductase family protein (.1) Lus10003051 [exp] 87 / 3e-22 AT5G38710 497 / 2e-173 Methylenetetrahydrofolate reductase family protein (.1) Lus10034095 [exp] 84 / 3e-21 AT5G38710 460 / 2e-160 Methylenetetrahydrofolate reductase family protein (.1) Lus10005114 [exp] 73 / 4e-17 AT3G30775 494 / 4e-172 proline dehydrogenase 1, EARLY RESPONSIVE TO DEHYDRATION 5, ARABIDOPSIS THALIANA PROLINE OXIDASE, Methylenetetrahydrofolate reductase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G109300 [exp] 72 / 4e-17 AT5G38710 501 / 3e-175 Methylenetetrahydrofolate reductase family protein (.1) Potri.004G106400 [exp] 69 / 6e-16 AT5G38710 532 / 0.0 Methylenetetrahydrofolate reductase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0086 [flax] [poplar] FAD_oxidored PF01619 [flax] [poplar] Pro_dh Proline dehydrogenase
Representative CDS sequence Show only first row Show all	>Lus10003052 pacid=23154519 polypeptide=Lus10003052 locus=Lus10003052.g ID=Lus10003052.BGIv1.0 annot-version=v1.0 ATGCCGTTTGGAGCGATTGATATAGTGATGCCGTATTTGGTTAGGAGGAGTGAAGAGAACAGAGGAATGCTCTCTGCTTCCAGGGTTGACAGACAGCTCA TCAGAAAGGAGTTGCAGAGAAGGATGAAAGCTGGAATCTTGGGGAAGCTGAATTAA
AA sequence Show only first row Show all	>Lus10003052 pacid=23154519 polypeptide=Lus10003052 locus=Lus10003052.g ID=Lus10003052.BGIv1.0 annot-version=v1.0 MPFGAIDIVMPYLVRRSEENRGMLSASRVDRQLIRKELQRRMKAGILGKLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38710			Methylenetetrahydrofolate redu...		Lus10003052 [exp]	0	1
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10015285 [exp]	7.6	0.7962
AT2G20820			unknown protein		Lus10037883 [exp]	31.1	0.8062
AT5G67390			unknown protein		Lus10011531 [exp]	37.4	0.7579
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029318 [exp]	48.4	0.7955
AT4G31750		WIN2	HOPW1-1-interacting 2 (.1)		Lus10020104 [exp]	118.1	0.7779
AT5G37990			S-adenosyl-L-methionine-depend...		Lus10028500 [exp]	122.4	0.7860
					Lus10016322 [exp]	129.6	0.7754
AT4G03240		ATFH, FH	frataxin homolog (.1)		Lus10039728 [exp]	236.3	0.7463
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10017866 [exp]	248.5	0.7434
AT3G17180		SCPL33	serine carboxypeptidase-like 3...		Lus10037810 [exp]	250.5	0.7467

Compare expression of checked genes

Lus10003052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.