Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26910 135 / 2e-41 RPL10B ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) AT1G14320 132 / 2e-40 RPL10A, RPL10, SAC52 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2) AT1G66580 130 / 2e-39 RPL10C, SAG24 ribosomal protein L10 C, senescence associated gene 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034092 [exp] 135 / 2e-42 AT1G26910 216 / 7e-73 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10031568 [exp] 116 / 3e-35 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10015106 [exp] 116 / 3e-35 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10035401 [exp] 115 / 5e-35 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10031002 [exp] 115 / 5e-35 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10012113 [exp] 115 / 6e-35 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10010429 [exp] 115 / 6e-35 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G159600 [exp] 144 / 5e-45 AT1G26910 411 / 3e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.019G131900 [exp] 142 / 2e-44 AT1G26910 410 / 6e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.013G159301 [exp] 127 / 2e-38 AT1G14320 222 / 2e-73 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00252 [flax] [poplar] Ribosomal_L16 Ribosomal protein L16p/L10e
Representative CDS sequence Show only first row Show all	>Lus10003055 pacid=23154533 polypeptide=Lus10003055 locus=Lus10003055.g ID=Lus10003055.BGIv1.0 annot-version=v1.0 ATGGTTCACCCCTTTCATGTCCTGCGTATCAACAAGATGCTTTCCTGCGCCGGAGCGGATAGGCTCCAGACTGGGATGAGGGGGGCCTTTGGGAAGCCGC GGGGTGTTTGTGCTAGGGTTGCGATTGGTCAGGTTCTGCTCTTGGTTCGGTGTAGGGATAGCCATAGCCATCACGCTCAGGAGGCTCTCCGCCGTGTCAA GTTCAAGTTCCCCGGGCCGTTGGCGAATCGAGAACCAGGAAGAGCTTTCTTGCACGCGGCTGCCAATGAATAG
AA sequence Show only first row Show all	>Lus10003055 pacid=23154533 polypeptide=Lus10003055 locus=Lus10003055.g ID=Lus10003055.BGIv1.0 annot-version=v1.0 MVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPRGVCARVAIGQVLLLVRCRDSHSHHAQEALRRVKFKFPGPLANREPGRAFLHAAANE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10003055 [exp]	0	1
AT5G58040		FIP1[V], ATFIP1...	homolog of yeast FIP1 [V], hom...		Lus10019609 [exp]	2.0	0.8867
AT5G54680	bHLH	bHLH105, ILR3	iaa-leucine resistant3, basic ...		Lus10020069 [exp]	2.0	0.9011
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10017822 [exp]	8.1	0.8819
AT1G48635		PEX3-2, PEX3	PEROXIN 3-2, peroxin 3 (.1.2)		Lus10018002 [exp]	10.7	0.8825
AT3G56310			Melibiase family protein (.1.2...		Lus10029046 [exp]	20.1	0.8780
AT4G17900			PLATZ transcription factor fam...		Lus10030968 [exp]	23.4	0.8857
AT2G02870			Galactose oxidase/kelch repeat...		Lus10030489 [exp]	25.7	0.8443
AT4G15563			unknown protein		Lus10012807 [exp]	25.9	0.8733
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10003772 [exp]	28.1	0.8396
AT1G32130		HNI9, ATIWS1	HIGH NITROGEN INSENSITIVE 9, A...		Lus10030992 [exp]	32.1	0.8830

Compare expression of checked genes

Lus10003055 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.