Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31290 259 / 5e-86 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) AT3G63090 84 / 3e-19 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT2G39120 61 / 6e-11 WTF9 what's this factor 9, Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT4G01037 60 / 1e-10 AtWTF1 what's this factor?, Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT4G33495 58 / 5e-10 RPD1 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT3G58520 57 / 6e-10 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) AT4G24320 57 / 7e-10 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT1G71850 57 / 7e-10 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT4G08940 57 / 1e-09 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT5G45790 55 / 5e-09 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003062 [exp] 370 / 2e-129 AT2G31290 558 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Lus10034086 [exp] 345 / 6e-120 AT2G31290 559 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Lus10028011 [exp] 87 / 3e-21 AT3G63090 261 / 6e-87 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10000096 [exp] 86 / 5e-20 AT3G63090 561 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10000098 [exp] 86 / 8e-20 AT3G63090 557 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10012374 [exp] 84 / 5e-19 AT3G63090 503 / 8e-176 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10035074 [exp] 70 / 4e-14 AT1G71850 479 / 5e-164 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10017896 [exp] 70 / 5e-14 AT1G71850 478 / 7e-164 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10005750 [exp] 65 / 2e-12 AT1G71850 263 / 9e-85 Ubiquitin carboxyl-terminal hydrolase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G191100 [exp] 274 / 6e-92 AT2G31290 575 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Potri.002G220000 [exp] 84 / 3e-19 AT3G63090 499 / 7e-177 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.002G245100 [exp] 67 / 4e-13 AT1G06440 544 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.006G218100 [exp] 66 / 1e-12 AT5G21970 566 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.002G244900 [exp] 65 / 1e-12 AT1G06440 503 / 7e-180 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.002G069151 [exp] 58 / 5e-12 AT2G31290 78 / 5e-19 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Potri.015G141700 [exp] 61 / 5e-11 AT4G33495 607 / 0.0 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.006G195900 [exp] 61 / 5e-11 AT3G58520 578 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Potri.001G439100 [exp] 61 / 5e-11 AT1G79120 483 / 2e-170 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.004G223200 [exp] 58 / 4e-10 AT4G24320 437 / 4e-152 Ubiquitin carboxyl-terminal hydrolase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11955 [flax] [poplar] PORR Plant organelle RNA recognition domain
Representative CDS sequence Show only first row Show all	>Lus10003059 pacid=23154520 polypeptide=Lus10003059 locus=Lus10003059.g ID=Lus10003059.BGIv1.0 annot-version=v1.0 ATGTATATGAGACTCATGTTCGCTCAAATGCTAGTCAATCGCAGTACTAAGCACAACTCTTTGCCTTCACTGCTTCATCTCTTTCGTGATTTTTCTCTCT GGTCTATGAAGAAGGATCCTGATCTGGAATCTGCTCTATCTCGAAACCGTAGATGGATAGTCAACAATCAAATCAAGAACATTATTCTTAGATGTCCAGA TCAGGTTGCCCCTATCAAACACCTCCAGAAAAAGTTTAGAACTCTTGATCTTCAAGGCAAAGCCCTCAATTGGCTGAAGAAATACCCCTGTTGTTTCGAG GTATATCTACAGAATAACGAATACTACTGTCGGTTAACTAAGCGGATGCTTTCATTAGTCGAGGAGGAAGATTCTGTTAAAGAAATGCAGGAGCCTGTTT ATGCAGAGCGGCTGGCCAAGTTGTTGATGCTGACGAATAACCAAAGGCTCAATGTTGTCAAACTCGGCGAGCTGAAACGAAACTTGGGATTTCCGGATGA TTATATTATCAGAATTCTCCCAAAATATCCCGACATGTTTCAATTCATCCCTAATTAA
AA sequence Show only first row Show all	>Lus10003059 pacid=23154520 polypeptide=Lus10003059 locus=Lus10003059.g ID=Lus10003059.BGIv1.0 annot-version=v1.0 MYMRLMFAQMLVNRSTKHNSLPSLLHLFRDFSLWSMKKDPDLESALSRNRRWIVNNQIKNIILRCPDQVAPIKHLQKKFRTLDLQGKALNWLKKYPCCFE VYLQNNEYYCRLTKRMLSLVEEEDSVKEMQEPVYAERLAKLLMLTNNQRLNVVKLGELKRNLGFPDDYIIRILPKYPDMFQFIPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31290			Ubiquitin carboxyl-terminal hy...		Lus10003059 [exp]	0	1
AT1G48310		CHR18, CHA18	chromatin remodeling factor18 ...		Lus10006642 [exp]	1.0	0.7082
AT4G20310			Peptidase M50 family protein (...		Lus10038402 [exp]	10.2	0.6185
AT5G15010			Tetratricopeptide repeat (TPR)...		Lus10021991 [exp]	16.3	0.6972
AT5G46190			RNA-binding KH domain-containi...		Lus10038509 [exp]	18.9	0.6928
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Lus10014244 [exp]	20.2	0.6809
AT2G40930		PDE323, ATUBP5,...	PIGMENT DEFECTIVE EMBRYO 323, ...		Lus10038994 [exp]	52.4	0.6551
AT1G06150	bHLH	bHLH089, EMB144...	EMBRYO DEFECTIVE 1444, basic h...		Lus10008825 [exp]	89.3	0.5933
AT3G02065			P-loop containing nucleoside t...		Lus10006736 [exp]	96.0	0.6147
AT5G66380		ATFOLT1	folate transporter 1 (.1)		Lus10028339 [exp]	110.2	0.6024
AT1G55630			Pentatricopeptide repeat (PPR)...		Lus10027465 [exp]	122.0	0.5856

Compare expression of checked genes

Lus10003059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.