Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45070 59 / 1e-11 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G45080 59 / 1e-11 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G74090 58 / 2e-11 SOT18, ATSOT18, ATST5B ARABIDOPSIS SULFOTRANSFERASE 5B, desulfo-glucosinolate sulfotransferase 18 (.1) AT1G18590 57 / 3e-11 SOT17, ATSOT17, ATST5C ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) AT2G27570 57 / 3e-11 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G74100 57 / 7e-11 SOT16, ATSOT16, CORI-7, ATST5A CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) AT2G03760 56 / 8e-11 AtSOT12, AtSOT1, ATST1, RAR047, ST ARABIDOPSIS THALIANA SULFOTRANSFERASE 1, sulphotransferase 12 (.1) AT1G13420 56 / 8e-11 SST1, ATST4B ARABIDOPSIS THALIANA SULFOTRANSFERASE 4B, sulfotransferase 4B (.1) AT1G28170 55 / 3e-10 SOT7 sulphotransferase 7 (.1) AT5G43690 52 / 4e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003070 [exp] 126 / 6e-37 AT3G45070 219 / 2e-69 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10034079 [exp] 122 / 2e-35 AT3G45070 206 / 1e-64 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022904 [exp] 91 / 1e-25 AT1G74100 63 / 3e-13 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Lus10033721 [exp] 96 / 1e-24 AT1G18590 223 / 6e-67 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Lus10031621 [exp] 92 / 2e-24 AT1G74100 182 / 5e-56 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Lus10033720 [exp] 91 / 2e-23 AT1G74100 229 / 6e-73 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Lus10031623 [exp] 89 / 1e-22 AT2G03760 201 / 3e-62 ARABIDOPSIS THALIANA SULFOTRANSFERASE 1, sulphotransferase 12 (.1) Lus10033718 [exp] 86 / 1e-21 AT1G74100 209 / 3e-65 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Lus10031624 [exp] 86 / 2e-21 AT3G45070 209 / 2e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G048200 [exp] 67 / 2e-14 AT1G18590 273 / 7e-90 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.003G193400 [exp] 66 / 2e-14 AT5G07010 393 / 6e-137 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1) Potri.003G193300 [exp] 66 / 3e-14 AT5G07010 378 / 4e-131 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1) Potri.011G048300 [exp] 66 / 3e-14 AT1G18590 244 / 1e-78 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.011G048712 [exp] 66 / 3e-14 AT1G18590 265 / 1e-86 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.003G193250 [exp] 65 / 7e-14 AT5G07010 395 / 9e-138 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1) Potri.011G048100 [exp] 63 / 3e-13 AT1G74100 251 / 1e-81 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Potri.001G036600 [exp] 62 / 7e-13 AT5G07010 292 / 2e-97 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1) Potri.011G049100 [exp] 61 / 1e-12 AT1G18590 266 / 3e-87 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.011G048400 [exp] 60 / 4e-12 AT1G18590 248 / 2e-80 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00685 [flax] [poplar] Sulfotransfer_1 Sulfotransferase domain
Representative CDS sequence Show only first row Show all	>Lus10003069 pacid=23154546 polypeptide=Lus10003069 locus=Lus10003069.g ID=Lus10003069.BGIv1.0 annot-version=v1.0 ATGAGGAAGGAGAAGTTGAGAAGGCTATATGGAGAAGCAGCTTCGACAGGGCTTAAGGATTTGGAAGTCAACAAGACAGGGAAGCCACCACAAGCGAGCT TGGTTCCTCTTATGAGGAACAATCACTTCTTCCGTCGAGGGGAAGTTGGAGACTGGAGGAACTACTTGAGTCTGGAGATGGCGAAACGTATTGATGACAT CACGAGGAACAAGTTTCGAGGTACTGGGCTTTATATGGATGAGGAGGATGCTTTTTAA
AA sequence Show only first row Show all	>Lus10003069 pacid=23154546 polypeptide=Lus10003069 locus=Lus10003069.g ID=Lus10003069.BGIv1.0 annot-version=v1.0 MRKEKLRRLYGEAASTGLKDLEVNKTGKPPQASLVPLMRNNHFFRRGEVGDWRNYLSLEMAKRIDDITRNKFRGTGLYMDEEDAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74090		SOT18, ATSOT18,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Lus10003069 [exp]	0	1
AT2G22475		GEM	GL2-EXPRESSION MODULATOR, GRAM...		Lus10010279 [exp]	6.2	0.9002
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10020730 [exp]	7.1	0.8230
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10031760 [exp]	8.7	0.8170
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Lus10042239 [exp]	11.5	0.8294
					Lus10041663 [exp]	13.0	0.8414
AT3G45070			P-loop containing nucleoside t...		Lus10003070 [exp]	16.1	0.8573
AT1G69880		ATH8	thioredoxin H-type 8 (.1)		Lus10037225 [exp]	22.8	0.8541
AT4G32870			Polyketide cyclase/dehydrase a...		Lus10006042 [exp]	24.6	0.8457
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Lus10033405 [exp]	27.9	0.8506
AT2G17700		STY8	serine/threonine/tyrosine kina...		Lus10004153 [exp]	29.6	0.8456

Compare expression of checked genes

Lus10003069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.