Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47580 44 / 3e-06 Leucine-rich repeat protein kinase family protein (.1) AT3G47570 42 / 1e-05 Leucine-rich repeat protein kinase family protein (.1) AT2G24130 38 / 0.0005 Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034078 [exp] 139 / 1e-43 AT3G47090 74 / 1e-15 Leucine-rich repeat protein kinase family protein (.1) Lus10033362 [exp] 106 / 5e-28 AT3G47570 784 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10035429 [exp] 106 / 5e-28 AT3G47570 771 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10031043 [exp] 101 / 2e-26 AT3G47570 756 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10033329 [exp] 96 / 2e-24 AT3G47570 794 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10033330 [exp] 81 / 4e-19 AT3G47570 783 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10035726 [exp] 71 / 2e-15 AT3G47570 716 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10033363 [exp] 70 / 4e-15 AT3G47570 758 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10037310 [exp] 67 / 3e-14 AT3G47570 744 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G102700 [exp] 64 / 4e-13 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.019G100901 [exp] 63 / 7e-13 AT5G39390 394 / 9e-133 Leucine-rich repeat protein kinase family protein (.1) Potri.018G020000 [exp] 61 / 4e-12 AT3G47570 816 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228200 [exp] 61 / 6e-12 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G034000 [exp] 59 / 2e-11 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G080000 [exp] 59 / 3e-11 AT3G47570 818 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.015G037400 [exp] 58 / 4e-11 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G099100 [exp] 57 / 7e-11 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G007866 [exp] 57 / 9e-11 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G115900 [exp] 56 / 2e-10 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003071 pacid=23154530 polypeptide=Lus10003071 locus=Lus10003071.g ID=Lus10003071.BGIv1.0 annot-version=v1.0 ATGTTCGAAGAAGGTGCGAATCTCCGAGAATTGGTGAAAGCAGCAATTCCCGATGGAATAACATCAGTATTAGACCCATCGGTGTGTCTTTCTTTAACTA CTAGCATCAACATTGCAGAATCTGGCCGTATGTCTGAAAGTGCCAGAGAGTGTTTGGCATCAGTACTTGAAATTGGTGTGAGTTGCTCCTCAGAAACGGC AGGAGAACGTATGAAGACGGCTGATGTTGCTAGAGAGATGGCTTCTGTTCGCGACGTTTTTGTTGCAGCAACCACCGCTAGGAGGCACAGGCGACAACGA GGCTGA
AA sequence Show only first row Show all	>Lus10003071 pacid=23154530 polypeptide=Lus10003071 locus=Lus10003071.g ID=Lus10003071.BGIv1.0 annot-version=v1.0 MFEEGANLRELVKAAIPDGITSVLDPSVCLSLTTSINIAESGRMSESARECLASVLEIGVSCSSETAGERMKTADVAREMASVRDVFVAATTARRHRRQR G

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47090			Leucine-rich repeat protein ki...		Lus10003071 [exp]	0	1
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10018525 [exp]	2.0	0.9005
AT3G47570			Leucine-rich repeat protein ki...		Lus10003072 [exp]	2.0	0.9040
AT5G10530			Concanavalin A-like lectin pro...		Lus10029555 [exp]	6.9	0.8923
AT1G54540			Late embryogenesis abundant (L...		Lus10031317 [exp]	12.6	0.8739
AT5G25900		ATKO1, CYP701A3...	CYTOCHROME P450 701 A3, ARABID...		Lus10032747 [exp]	14.8	0.8563
					Lus10009436 [exp]	15.3	0.8675
AT4G38960	CO		B-box type zinc finger family ...		Lus10035472 [exp]	16.6	0.8246
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10039743 [exp]	20.8	0.8649
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10033098 [exp]	22.0	0.7314
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	22.4	0.8237

Compare expression of checked genes

Lus10003071 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.