Lus10003076 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38630 253 / 3e-86 ACYB-1 cytochrome B561-1 (.1)
AT1G26100 154 / 2e-47 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT4G25570 142 / 9e-43 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 112 / 7e-31 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034074 305 / 1e-105 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10039216 164 / 4e-51 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 160 / 5e-49 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 158 / 1e-48 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10021715 144 / 4e-43 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 143 / 1e-42 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034427 111 / 1e-30 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 101 / 9e-27 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10035096 96 / 3e-23 AT2G02010 835 / 0.0 glutamate decarboxylase 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G111700 280 / 6e-97 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.004G103800 276 / 3e-95 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 227 / 6e-76 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.008G115200 163 / 8e-51 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 163 / 1e-50 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 150 / 9e-46 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 149 / 2e-45 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 123 / 2e-35 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 119 / 1e-33 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10003076 pacid=23154545 polypeptide=Lus10003076 locus=Lus10003076.g ID=Lus10003076.BGIv1.0 annot-version=v1.0
ATGGTGATCGGACTTCTACTTATGAATGGTGAAGCCATGTTAGCCTACAAGACAACTCCAGGAACCAAAAACTTCAAAAAGCTCGTGCATCTTGGCCTGC
AGTTTCTTGCTCTCTGTTTGAGCTTGATTGGCGTGTGGGCTGCCTTGAAGTTCCACAACGATAAGGGCATTGACAACTTCTACAGTCTGCACTCGTGGCT
AGGCCTAGCATGCCTTTTCCTCTTCGGCATTCAGTGGGCTGCAGGGTTCTTGACCTTTTGGTACCCAGGCGGTTCGAGAAACAGCAGAGCAACTTTAATG
CCGTGGCATATCTTCTTTGGAGTTTATATATATGCACTTGCTATTGTTACAGCTACAACTGGTCTGCTCGAGAAAGCCACATTCCTTCAAATCAACAAGG
TGATAACACGCTATTCGACGGAGGCTTTGATGGTAAACTCATTGGGAATCTTGATCGTTGTTCTTGGAGGATTTGTTGTTCTCGCGGTGGTAACTCCTCC
ACGCGGCAAAGGTGAAATGCCCAGGAACGCGACGGAGTAG
AA sequence
>Lus10003076 pacid=23154545 polypeptide=Lus10003076 locus=Lus10003076.g ID=Lus10003076.BGIv1.0 annot-version=v1.0
MVIGLLLMNGEAMLAYKTTPGTKNFKKLVHLGLQFLALCLSLIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFGIQWAAGFLTFWYPGGSRNSRATLM
PWHIFFGVYIYALAIVTATTGLLEKATFLQINKVITRYSTEALMVNSLGILIVVLGGFVVLAVVTPPRGKGEMPRNATE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38630 ACYB-1 cytochrome B561-1 (.1) Lus10003076 0 1
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Lus10001524 1.4 0.9667
AT1G11925 Stigma-specific Stig1 family p... Lus10012679 2.4 0.9441
AT5G03290 IDH-V isocitrate dehydrogenase V (.1... Lus10026519 4.2 0.9451
AT5G43940 PAR2, ATGSNOR1,... PARAQUAT RESISTANT 2, sensitiv... Lus10000496 5.5 0.9417
AT5G03290 IDH-V isocitrate dehydrogenase V (.1... Lus10013806 6.0 0.9359
AT1G73160 UDP-Glycosyltransferase superf... Lus10032187 8.0 0.9439
AT1G28120 unknown protein Lus10026630 10.7 0.9430
AT1G30890 Integral membrane HRF1 family ... Lus10025577 11.5 0.9324
AT1G67325 Ran BP2/NZF zinc finger-like s... Lus10006412 11.6 0.9273
AT3G56490 HIT3, HINT1 HISTIDINE TRIAD NUCLEOTIDE-BIN... Lus10031011 11.8 0.9193

Lus10003076 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.