Lus10003077 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38650 193 / 1e-64 Proteasome maturation factor UMP1 (.1)
AT1G67250 190 / 3e-63 Proteasome maturation factor UMP1 (.1)
AT5G38660 194 / 3e-61 APE1 acclimation of photosynthesis to environment (.1.2)
AT1G62920 0 / 1 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034073 265 / 4e-93 AT5G38660 197 / 3e-66 acclimation of photosynthesis to environment (.1.2)
Lus10005377 66 / 7e-15 AT5G38650 54 / 2e-10 Proteasome maturation factor UMP1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G249600 185 / 2e-61 AT1G67250 186 / 7e-62 Proteasome maturation factor UMP1 (.1)
Potri.017G111900 184 / 5e-61 AT1G67250 187 / 2e-62 Proteasome maturation factor UMP1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05348 UMP1 Proteasome maturation factor UMP1
Representative CDS sequence
>Lus10003077 pacid=23154514 polypeptide=Lus10003077 locus=Lus10003077.g ID=Lus10003077.BGIv1.0 annot-version=v1.0
ATGGAAGGAGCACCCACGACGTTAGCACAGAAAGCCGGAGAAATCGAGAAGGATCCGCTTCGATGCGGCCTCCATGGCGTTAAAAGCGACATCGTCGGAT
CTCACCCTCTCCAAGCTGCATATGGATCTACTATTAGAACTCAAGAAGACATGAAGAGGAGAGTCCTTGCAAACACTTACGGATCCGCCTTCCCTGTGAA
GATGGACCTGGAAAGGCAATTTCTTACCCGATTCCAGAGACCACCGGGTGCTATTCCTTCATCAATGCTTGGGTTGGAAGCCATGACTGGAAGCTTGGAT
GATTTTGGTTTCGAGGATTATCTTAATGATCCTCGTGAATCTGAAGTCTATCGACCAGTGGACATGCACCATGGGTTGGAGGTTCACCTGGCCCTGTCCA
AGGGACCGGTTCAACGTTCTTTCATCTGA
AA sequence
>Lus10003077 pacid=23154514 polypeptide=Lus10003077 locus=Lus10003077.g ID=Lus10003077.BGIv1.0 annot-version=v1.0
MEGAPTTLAQKAGEIEKDPLRCGLHGVKSDIVGSHPLQAAYGSTIRTQEDMKRRVLANTYGSAFPVKMDLERQFLTRFQRPPGAIPSSMLGLEAMTGSLD
DFGFEDYLNDPRESEVYRPVDMHHGLEVHLALSKGPVQRSFI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38660 APE1 acclimation of photosynthesis ... Lus10003077 0 1
AT3G56740 Ubiquitin-associated (UBA) pro... Lus10038976 1.4 0.8988
AT5G19990 ATSUG1, RPT6A regulatory particle triple-A A... Lus10033055 2.2 0.8807
AT5G47060 Protein of unknown function (D... Lus10019494 2.4 0.8934
AT2G20140 RPT2b regulatory particle AAA-ATPase... Lus10011901 3.3 0.8395
AT2G27030 CAM5, CAM2, ACA... calmodulin 5 (.1.2.3) Lus10038981 3.9 0.8842
AT2G28720 Histone superfamily protein (.... Lus10017456 4.2 0.8267
AT1G04690 KV-BETA1, KAB1 potassium channel beta subunit... Lus10023674 4.5 0.8479
AT5G65430 14-3-3KAPPA, GF... 14-3-3 PROTEIN G-BOX FACTOR14 ... Lus10035934 6.0 0.8815
AT2G41150 unknown protein Lus10022403 6.0 0.8619
AT2G38760 ANN3, ANNAT3 annexin 3 (.1) Lus10024172 9.2 0.8604

Lus10003077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.