Lus10003089 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53840 54 / 3e-08 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT1G80960 50 / 4e-07 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
AT1G78730 46 / 1e-05 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1)
AT1G67390 44 / 3e-05 F-box family protein (.1)
AT2G42730 44 / 4e-05 F-box family protein (.1.2)
AT5G03100 42 / 0.0001 F-box/RNI-like superfamily protein (.1)
AT1G13570 42 / 0.0002 F-box/RNI-like superfamily protein (.1)
AT1G55660 41 / 0.0004 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
AT1G60410 41 / 0.0004 F-box family protein (.1)
AT4G00315 41 / 0.0004 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028602 187 / 4e-58 AT1G80960 50 / 1e-06 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Lus10018863 173 / 2e-53 AT5G44950 62 / 1e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10028722 143 / 7e-40 AT2G42730 76 / 1e-14 F-box family protein (.1.2)
Lus10028558 112 / 3e-31 AT3G51530 56 / 4e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10004525 118 / 9e-31 AT4G01840 402 / 3e-137 Ca2+ activated outward rectifying K+ channel 5, Ca2+ activated outward rectifying K+ channel 5 (.1)
Lus10028721 103 / 5e-28 AT5G53840 56 / 5e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10011268 91 / 3e-22 AT5G41630 52 / 7e-08 F-box/RNI-like superfamily protein (.1)
Lus10028649 93 / 2e-21 AT1G21380 452 / 7e-152 Target of Myb protein 1 (.1)
Lus10011267 83 / 1e-18 ND 39 / 0.002
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G224975 69 / 1e-13 AT5G53840 48 / 4e-06 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.011G098700 49 / 1e-06 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Potri.015G011200 42 / 0.0003 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
Potri.017G107600 41 / 0.0004 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1)
Potri.002G132400 40 / 0.0006 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10003089 pacid=23174300 polypeptide=Lus10003089 locus=Lus10003089.g ID=Lus10003089.BGIv1.0 annot-version=v1.0
ATGGCTTCTGACTCTGTTTCTATTGGAACGGAAGTATTCGATGTGGCTTTGGACTCTGTTTGTACATCACAAAAAGGAGAAGAAGTTGAATTGGGTTGGA
ATAGTCAGCTGCCCGATGAAGTTGTCATCGATATCATATCTCGTTTGTCTCTCGCTGAAGCCATTAGAACATCATTCCTCTCAAGTAGGTGGATAAACTC
GTGGAAATCAGCACTTTCGGTGCTCGACTTTGATGCCTCAAAGGAGTTGGTATCTTTACGCAGGATCGCCTCAACAAAATCTGATAGACTACTTCCCAAC
AAGAGGCGTCAGTACATGAATTGGGTGAACTGTGTTATCAAAACACCAGCTGGATTGCATGATATTAGCTTCTTGAGATCCTTGTGCTTGACTAATGTTA
ATGTTGGGGACGAGATTCTTGAACATTTCATTGCCAATTGCCCCATGATTGAAGAGTTAGTTGTGAAATGGTCAGATCGTCTGAAAAAGCTCAAGGTTGT
AGGTTCTTCATTGAATTTGAAGCACTTGAAAGTAAGAGCTTGCCCATTTTTCAAATCTGTAGAGATTGATCATGCCCCTCACCTCGAGCGTTTGATATGT
TCTGGCGGTGGCCGTGTGAAGGAAATCAAAGTGGGTAATTGCTCATCGCTTGTGGATATGACCTTATGTAACGAGTTTATTTGCAGTCAAATGGTTGTTG
GATAA
AA sequence
>Lus10003089 pacid=23174300 polypeptide=Lus10003089 locus=Lus10003089.g ID=Lus10003089.BGIv1.0 annot-version=v1.0
MASDSVSIGTEVFDVALDSVCTSQKGEEVELGWNSQLPDEVVIDIISRLSLAEAIRTSFLSSRWINSWKSALSVLDFDASKELVSLRRIASTKSDRLLPN
KRRQYMNWVNCVIKTPAGLHDISFLRSLCLTNVNVGDEILEHFIANCPMIEELVVKWSDRLKKLKVVGSSLNLKHLKVRACPFFKSVEIDHAPHLERLIC
SGGGRVKEIKVGNCSSLVDMTLCNEFICSQMVVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53840 F-box/RNI-like/FBD-like domain... Lus10003089 0 1

Lus10003089 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.