Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63420 104 / 1e-30 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) AT3G22942 97 / 9e-28 AtGG2, AGG2 G-protein gamma subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014714 [exp] 206 / 2e-70 AT3G63420 104 / 2e-30 Ggamma-subunit 1 (.1.2) Lus10029687 [exp] 69 / 4e-16 AT3G63420 69 / 4e-16 Ggamma-subunit 1 (.1.2) Lus10042727 [exp] 69 / 6e-16 AT3G63420 70 / 3e-16 Ggamma-subunit 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G046900 [exp] 134 / 3e-42 AT3G63420 102 / 1e-29 Ggamma-subunit 1 (.1.2) Potri.015G142500 [exp] 126 / 3e-39 AT3G22942 100 / 4e-29 G-protein gamma subunit 2 (.1) Potri.005G216100 [exp] 125 / 2e-38 AT3G63420 103 / 4e-30 Ggamma-subunit 1 (.1.2) Potri.005G179600 [exp] 81 / 6e-21 AT3G63420 81 / 3e-21 Ggamma-subunit 1 (.1.2) Potri.002G081500 [exp] 75 / 1e-18 AT3G63420 62 / 1e-13 Ggamma-subunit 1 (.1.2) Potri.018G062400 [exp] 38 / 0.0005 AT5G20635 112 / 3e-30 Arabidopsis G protein gamma subunit 3, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003092 pacid=23174298 polypeptide=Lus10003092 locus=Lus10003092.g ID=Lus10003092.BGIv1.0 annot-version=v1.0 ATGGATTCTGAACCCACCTCGTCCGTGGACGAGGAGGCTCTCGTTGCCGGAACTCTCGGAGCAGCTGATACCAGAGGGAAACATCGGATTCTTGCCGAGC TCAAGCGGATCGAGCAAGAAATCAGCTTTCTTGAGAGGGAACTAGACGAACTTGACAAAACAGACAATGTATCGACTGTATGCGAAGGATTCTTGCACAA TGTGGAGACGATACCAGATCCACTGCTCTCAATAACGATTGGCCCTGCTAACCCGATATGGGACCGATGGTTTGAGGGTACTCCAGATGCTGGCGGTTGC AGCTGTACCATACTCTGA
AA sequence Show only first row Show all	>Lus10003092 pacid=23174298 polypeptide=Lus10003092 locus=Lus10003092.g ID=Lus10003092.BGIv1.0 annot-version=v1.0 MDSEPTSSVDEEALVAGTLGAADTRGKHRILAELKRIEQEISFLERELDELDKTDNVSTVCEGFLHNVETIPDPLLSITIGPANPIWDRWFEGTPDAGGC SCTIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G63420		AGG1, ATAGG1	Ggamma-subunit 1 (.1.2)		Lus10003092 [exp]	0	1
AT1G67170			unknown protein		Lus10019966 [exp]	5.7	0.8723
AT5G64010			unknown protein		Lus10035852 [exp]	6.7	0.8693
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10028192 [exp]	13.5	0.8633
AT2G39530			Uncharacterised protein family...		Lus10031303 [exp]	13.5	0.8757
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Lus10034375 [exp]	15.8	0.8781
AT4G33000		SCABP8, ATCBL10...	SOS3-LIKE CALCIUM BINDING PROT...		Lus10015630 [exp]	17.3	0.8828
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10025309 [exp]	21.5	0.8706
AT1G28540			unknown protein		Lus10025433 [exp]	25.0	0.8621
AT1G30500	CCAAT	NF-YA7	"nuclear factor Y, subunit A7"...		Lus10012202 [exp]	25.0	0.8717
AT2G19790			SNARE-like superfamily protein...		Lus10035004 [exp]	27.1	0.8478

Compare expression of checked genes

Lus10003092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.