Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78690 67 / 2e-14 Phospholipid/glycerol acyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004783 [exp] 78 / 2e-18 AT1G78690 353 / 2e-123 Phospholipid/glycerol acyltransferase family protein (.1) Lus10004768 [exp] 66 / 3e-15 AT1G78690 99 / 5e-27 Phospholipid/glycerol acyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G146800 [exp] 74 / 1e-16 AT1G78690 380 / 9e-134 Phospholipid/glycerol acyltransferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003105 pacid=23165949 polypeptide=Lus10003105 locus=Lus10003105.g ID=Lus10003105.BGIv1.0 annot-version=v1.0 ATGGCTGGGATTACAAGGAACGCAGTGTTTGTGACCATTGGTGCCTTTGCTAAGGCAGTGACAAATCTTTTGAACTATACATCTGTCCAAAATGCACGCA CTCTACTTCACCCATCTGTCCAAAATGCACACACTCTACTTCACCTAGTTCGATCTCGGTCGCCTCGTGTACCTCTTATCACTCTGCACACATACCCTGA GAGAAAGGTCAACAAAGAAATTGGACATGTAAGATGGTTGAAATGGGGAACTGCCACTCTCATCGTATGTTCCCCTGTTACACCGATAGTATTACCCATT GTTCATCATGGCTTTCAAGAGATGGCAAAGCCTTAA
AA sequence Show only first row Show all	>Lus10003105 pacid=23165949 polypeptide=Lus10003105 locus=Lus10003105.g ID=Lus10003105.BGIv1.0 annot-version=v1.0 MAGITRNAVFVTIGAFAKAVTNLLNYTSVQNARTLLHPSVQNAHTLLHLVRSRSPRVPLITLHTYPERKVNKEIGHVRWLKWGTATLIVCSPVTPIVLPI VHHGFQEMAKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78690			Phospholipid/glycerol acyltran...		Lus10003105 [exp]	0	1
					Lus10039535 [exp]	10.0	0.6069
AT5G46050		ATPTR3, PTR3	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10008232 [exp]	10.2	0.5865
AT4G10120		ATSPS4F	Sucrose-phosphate synthase fam...		Lus10006185 [exp]	12.6	0.5346
AT2G23970			Class I glutamine amidotransfe...		Lus10014635 [exp]	14.0	0.5675
AT4G02280		ATSUS3, SUS3	sucrose synthase 3 (.1)		Lus10008204 [exp]	19.0	0.5921
AT5G48600		ATSMC4, SMC4, A...	ARABIDOPSIS THALIANA STRUCTURA...		Lus10030681 [exp]	19.9	0.5854
AT4G02250			Plant invertase/pectin methyle...		Lus10001464 [exp]	24.6	0.5819
					Lus10019563 [exp]	30.4	0.5693
AT1G73050			Glucose-methanol-choline (GMC)...		Lus10034845 [exp]	44.1	0.5100
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10009500 [exp]	45.0	0.5496

Compare expression of checked genes

Lus10003105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.