Lus10003117 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27340 165 / 6e-50 Galactose oxidase/kelch repeat superfamily protein (.1)
AT1G30950 54 / 4e-09 UFO UNUSUAL FLORAL ORGANS, F-box family protein (.1)
AT4G33160 49 / 2e-07 F-box family protein (.1)
AT5G15710 40 / 0.0003 Galactose oxidase/kelch repeat superfamily protein (.1)
AT5G43190 39 / 0.0004 Galactose oxidase/kelch repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015775 187 / 1e-58 AT1G27340 598 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10037030 187 / 2e-58 AT1G27340 615 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10011354 161 / 3e-50 AT1G27340 187 / 2e-56 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10018690 49 / 3e-07 AT1G30950 514 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Lus10007755 45 / 3e-06 AT1G30950 514 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Lus10035147 39 / 0.0005 AT5G15710 721 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10031955 39 / 0.001 AT5G15710 719 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G057100 167 / 1e-50 AT1G27340 613 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.003G171300 165 / 6e-50 AT1G27340 628 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.006G217500 65 / 4e-13 AT4G33160 419 / 9e-145 F-box family protein (.1)
Potri.003G074100 44 / 1e-05 AT1G30950 528 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Potri.004G112400 42 / 3e-05 AT5G15710 753 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.017G102300 41 / 8e-05 AT5G15710 744 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.001G160900 39 / 0.0005 AT1G30950 554 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
PFAM info
Representative CDS sequence
>Lus10003117 pacid=23169993 polypeptide=Lus10003117 locus=Lus10003117.g ID=Lus10003117.BGIv1.0 annot-version=v1.0
ATGGGGACATGGAAGCAACTCGCAATCCCAGCTCCGCGCCTTCTGTGTGAGTGTGTGCTTGCCGAATGCAAGGGGCGGATCATGCTCGTGGGACTCCTGA
CACAAAAGGCAGCAACGTCTGTTATCGTATGGGAGCTGCAGAGATCGACGCTGTTGTGGAAGGAGGTGGACAGAATGCCGAACGCATGGTGCTTGGAGTT
CTACGGTAAGAGATTTCGAATTACTTGCTTGGGCAACAAAGATATGGTCATGCTCTCTTTGAGCGTAGGTGATATAAACCGGTTAGTGATGTACGATATG
GCGAATCGAGAATGGAGCAAGGTTCCTCGATATTCGGTGCCTTGCGGTAGATCGAGACAGTGGAACGTTTCTGGCGCGCCATTTCACCCTTCCCCTACTT
CTATGGCCTGA
AA sequence
>Lus10003117 pacid=23169993 polypeptide=Lus10003117 locus=Lus10003117.g ID=Lus10003117.BGIv1.0 annot-version=v1.0
MGTWKQLAIPAPRLLCECVLAECKGRIMLVGLLTQKAATSVIVWELQRSTLLWKEVDRMPNAWCLEFYGKRFRITCLGNKDMVMLSLSVGDINRLVMYDM
ANREWSKVPRYSVPCGRSRQWNVSGAPFHPSPTSMA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G27340 Galactose oxidase/kelch repeat... Lus10003117 0 1
AT1G59950 NAD(P)-linked oxidoreductase s... Lus10039266 1.0 0.9226
AT5G61280 Remorin family protein (.1) Lus10034714 2.4 0.8686
AT1G03910 unknown protein Lus10030000 2.4 0.8471
AT1G65910 NAC ANAC028 NAC domain containing protein ... Lus10010959 4.5 0.8603
Lus10024086 5.1 0.8311
Lus10000538 6.7 0.8289
AT5G49810 MMT methionine S-methyltransferase... Lus10038132 7.2 0.8092
AT1G19670 CORI1, ATHCOR1,... CORONATINE-INDUCED PROTEIN 1, ... Lus10014702 10.6 0.8444
AT1G08070 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSIN... Lus10030053 10.7 0.8685
AT1G27180 disease resistance protein (TI... Lus10008519 11.0 0.8174

Lus10003117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.