Lus10003118 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27340 94 / 3e-23 Galactose oxidase/kelch repeat superfamily protein (.1)
AT3G61590 52 / 2e-08 HWS, HS HAWAIIAN SKIRT, Galactose oxidase/kelch repeat superfamily protein (.1.2)
AT5G15710 48 / 3e-07 Galactose oxidase/kelch repeat superfamily protein (.1)
AT3G16820 44 / 1e-05 F-box and associated interaction domains-containing protein (.1)
AT5G49610 42 / 3e-05 F-box family protein (.1)
AT3G17710 41 / 7e-05 F-box and associated interaction domains-containing protein (.1)
AT3G16740 41 / 8e-05 F-box and associated interaction domains-containing protein (.1)
AT3G17320 41 / 8e-05 F-box and associated interaction domains-containing protein (.1)
AT5G36820 41 / 0.0001 F-box and associated interaction domains-containing protein (.1)
AT5G36730 41 / 0.0001 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015775 115 / 3e-31 AT1G27340 598 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10037030 114 / 1e-30 AT1G27340 615 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10035147 50 / 9e-08 AT5G15710 721 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10031955 49 / 1e-07 AT5G15710 719 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10018690 44 / 1e-05 AT1G30950 514 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Lus10007755 44 / 1e-05 AT1G30950 514 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Lus10006734 39 / 0.0001 AT1G30920 54 / 4e-10 F-box family protein (.1)
Lus10013872 39 / 0.0006 AT3G06240 101 / 2e-23 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G057100 102 / 3e-26 AT1G27340 613 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.003G171300 102 / 3e-26 AT1G27340 628 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.004G112400 48 / 3e-07 AT5G15710 753 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.017G102300 46 / 1e-06 AT5G15710 744 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.001G160900 44 / 7e-06 AT1G30950 554 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Potri.003G074100 43 / 2e-05 AT1G30950 528 / 0.0 UNUSUAL FLORAL ORGANS, F-box family protein (.1)
Potri.002G166500 41 / 9e-05 AT3G61590 542 / 0.0 HAWAIIAN SKIRT, Galactose oxidase/kelch repeat superfamily protein (.1.2)
Potri.014G093200 40 / 0.0002 AT3G61590 538 / 0.0 HAWAIIAN SKIRT, Galactose oxidase/kelch repeat superfamily protein (.1.2)
Potri.002G007700 39 / 0.0004 AT5G42350 718 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.010G149000 39 / 0.0005 AT5G49610 528 / 0.0 F-box family protein (.1)
PFAM info
Representative CDS sequence
>Lus10003118 pacid=23170003 polypeptide=Lus10003118 locus=Lus10003118.g ID=Lus10003118.BGIv1.0 annot-version=v1.0
ATGGCTGAGAAATCGGAAAGCAAACCTTACGACGAGGCTCCACCCATAGTAGAGAAATGTCGGATGCAGCGCAGTAATCAACTGAAATGCGAGGTCATGG
AATCCGAAATCTGGAAGGACTCTCCAAAAGATCTGTTCGAAGCTGTCAACGCAAGGCTACCCGTTGCCGCTCTCTTCAGGTTCCGAACCGTCTGCCGGAA
ATGGAATTCCTTGCCGAGCTCAGATAGTTTTGCCCAAGCTCGAGGAGGAGGCATGATCAGTCTTTGGTTCTACACCGTCACTGACGAGGACACGAATTCG
GGAGCCATGTACGACCCTTCCTTGAAGAAATGGTACCCTCCTCCTCCGAAACTATCTCTGTCTCTGCCTCTCGAGACGATTGTCTTGCCGGTTGCTTCAG
CAGGAATCTAG
AA sequence
>Lus10003118 pacid=23170003 polypeptide=Lus10003118 locus=Lus10003118.g ID=Lus10003118.BGIv1.0 annot-version=v1.0
MAEKSESKPYDEAPPIVEKCRMQRSNQLKCEVMESEIWKDSPKDLFEAVNARLPVAALFRFRTVCRKWNSLPSSDSFAQARGGGMISLWFYTVTDEDTNS
GAMYDPSLKKWYPPPPKLSLSLPLETIVLPVASAGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G27340 Galactose oxidase/kelch repeat... Lus10003118 0 1
AT1G27170 transmembrane receptors;ATP bi... Lus10020537 4.8 0.7081
Lus10009807 10.7 0.6642
AT5G07630 lipid transporters (.1) Lus10027222 12.0 0.6141
Lus10035698 23.3 0.6289
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10037732 24.5 0.6907
AT3G06080 TBL10 TRICHOME BIREFRINGENCE-LIKE 10... Lus10034039 27.7 0.5960
AT1G17665 unknown protein Lus10006153 33.4 0.6361
AT5G15940 NAD(P)-binding Rossmann-fold s... Lus10016771 35.1 0.6636
Lus10008159 35.5 0.5940
AT1G61560 ATMLO6, MLO6 MILDEW RESISTANCE LOCUS O 6, S... Lus10036519 36.9 0.6414

Lus10003118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.