Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) AT5G63500 115 / 5e-36 Protein of unknown function (DUF 3339) (.1) AT5G08391 97 / 9e-29 Protein of unknown function (DUF 3339) (.1) AT3G27027 95 / 1e-27 Protein of unknown function (DUF 3339) (.1) AT3G27030 94 / 2e-26 unknown protein AT5G40980 89 / 4e-25 Protein of unknown function (DUF 3339) (.1) AT3G01950 86 / 6e-24 Protein of unknown function (DUF 3339) (.1) AT5G14110 84 / 2e-23 Protein of unknown function (DUF 3339) (.1) AT5G40970 77 / 1e-20 Protein of unknown function (DUF 3339) (.1) AT3G01940 70 / 1e-17 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011353 [exp] 134 / 4e-43 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 114 / 2e-35 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 113 / 7e-35 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 104 / 1e-31 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 103 / 4e-31 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10035201 [exp] 100 / 5e-30 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10032032 [exp] 100 / 5e-30 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10035198 [exp] 99 / 2e-29 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10032028 [exp] 99 / 2e-29 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170400 [exp] 118 / 6e-37 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 110 / 1e-33 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 106 / 2e-32 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 105 / 9e-32 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 102 / 8e-31 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G058001 [exp] 100 / 8e-30 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 100 / 9e-30 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 102 / 1e-29 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.012G100100 [exp] 95 / 1e-27 AT5G63500 79 / 1e-21 Protein of unknown function (DUF 3339) (.1) Potri.017G065444 [exp] 91 / 3e-26 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10003120 pacid=23170005 polypeptide=Lus10003120 locus=Lus10003120.g ID=Lus10003120.BGIv1.0 annot-version=v1.0 ATGGCGGATTGGGGGCCGGTGGTGATAGCGACGGTGCTGTTCGTGCTGCTGACTCCTGGGTTGCTGTTCCAGATCCCGGCGAGGGGCAGAGTGGCGGAGT TTGGGAATATGCAGACGAGTGGGGCCTCCATATTGGTCCACACCGTCATCTACTTTGGGCTCATCACCATCTTCCTCATCGCCATCGGAGTCCACATCTA CGCCGGATAG
AA sequence Show only first row Show all	>Lus10003120 pacid=23170005 polypeptide=Lus10003120 locus=Lus10003120.g ID=Lus10003120.BGIv1.0 annot-version=v1.0 MADWGPVVIATVLFVLLTPGLLFQIPARGRVAEFGNMQTSGASILVHTVIYFGLITIFLIAIGVHIYAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48660			Protein of unknown function (D...		Lus10003120 [exp]	0	1
AT5G39890			Protein of unknown function (D...		Lus10003861 [exp]	1.0	0.9871
AT2G18670			RING/U-box superfamily protein...		Lus10019979 [exp]	1.4	0.9869
AT3G59710			NAD(P)-binding Rossmann-fold s...		Lus10034835 [exp]	2.0	0.9818
AT5G25940			early nodulin-related (.1)		Lus10030052 [exp]	3.0	0.9844
					Lus10026740 [exp]	4.9	0.9735
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Lus10018926 [exp]	5.1	0.9732
AT1G17100			SOUL heme-binding family prote...		Lus10013045 [exp]	5.6	0.9608
AT2G36530		ENO2, LOS2	LOW EXPRESSION OF OSMOTICALLY ...		Lus10038904 [exp]	5.9	0.9810
AT5G11420			Protein of unknown function, D...		Lus10019724 [exp]	6.3	0.9789
AT3G08650			ZIP metal ion transporter fami...		Lus10035606 [exp]	6.7	0.9714

Compare expression of checked genes

Lus10003120 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.