Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011339 [exp] 130 / 9e-42 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G102100 [exp] 45 / 9e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003135 pacid=23170004 polypeptide=Lus10003135 locus=Lus10003135.g ID=Lus10003135.BGIv1.0 annot-version=v1.0 ATGATGAAGGGTAGAGGAGCTATGGCAAGTGTTGTGAAGATTCTACTGTTTGTTGTGGTGTTCATGTCTATGAATGCTTTGAGAGGTGGTGAAGCAGTGT TTGGGATTGACATGAACCCTTGCACACTCCTAAGCTGCCAAGATGCCTGCAAGAATCTTCTTGGGGATAAGTTTAACAGTGCCTCTTGCTACCAAGGAAT CATCTGTATGTGCTTTGGTTGA
AA sequence Show only first row Show all	>Lus10003135 pacid=23170004 polypeptide=Lus10003135 locus=Lus10003135.g ID=Lus10003135.BGIv1.0 annot-version=v1.0 MMKGRGAMASVVKILLFVVVFMSMNALRGGEAVFGIDMNPCTLLSCQDACKNLLGDKFNSASCYQGIICMCFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003135 [exp]	0	1
					Lus10011339 [exp]	1.0	0.9700
AT5G35732			unknown protein		Lus10006404 [exp]	4.9	0.8837
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Lus10017878 [exp]	7.4	0.8715
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10025819 [exp]	7.5	0.8934
AT3G06145			unknown protein		Lus10034029 [exp]	9.4	0.8446
AT2G05320			beta-1,2-N-acetylglucosaminylt...		Lus10001174 [exp]	10.4	0.8479
AT4G32020			unknown protein		Lus10005344 [exp]	10.7	0.8851
AT5G47810		PFK2	phosphofructokinase 2 (.1)		Lus10039992 [exp]	12.8	0.8270
AT2G43090			Aconitase/3-isopropylmalate de...		Lus10007804 [exp]	17.9	0.8592
AT4G33565			RING/U-box superfamily protein...		Lus10012745 [exp]	19.0	0.8597

Compare expression of checked genes

Lus10003135 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.