Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003136 [exp] 91 / 1e-22 AT1G69040 520 / 0.0 ACT domain repeat 4 (.1.2) Lus10011329 [exp] 83 / 4e-20 AT1G69040 515 / 0.0 ACT domain repeat 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G060100 [exp] 58 / 3e-11 AT1G69040 505 / 7e-178 ACT domain repeat 4 (.1.2) Potri.003G167800 [exp] 52 / 4e-09 AT1G69040 486 / 1e-170 ACT domain repeat 4 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003137 pacid=23169991 polypeptide=Lus10003137 locus=Lus10003137.g ID=Lus10003137.BGIv1.0 annot-version=v1.0 ATGGTGGTGGCACTGGTCATTGTGGTGGCCAGCAAGATTGACTTTTCTGCTGGTATTTTGTACCATAAGAAAGACTATTATAGTTTCTTATTTGTCTCAT GCCTTAAAGTCGAGATCGGACAGGCTATACTCCGTGTGAAGGAGGATTCGTACTCGAACTCGAGCTCGAGCTCCACAACGGTGGAGCAAGGTAAATTCTC TCTGGGGAATATCTTCAAATCTAGGTCAGAGAAGTTTCTGTATAACTTGGGGTTAATCAAGTCTTGTACTTGA
AA sequence Show only first row Show all	>Lus10003137 pacid=23169991 polypeptide=Lus10003137 locus=Lus10003137.g ID=Lus10003137.BGIv1.0 annot-version=v1.0 MVVALVIVVASKIDFSAGILYHKKDYYSFLFVSCLKVEIGQAILRVKEDSYSNSSSSSTTVEQGKFSLGNIFKSRSEKFLYNLGLIKSCT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003137 [exp]	0	1
AT3G02710			ARM repeat superfamily protein...		Lus10026721 [exp]	1.0	0.9071
AT5G45920			SGNH hydrolase-type esterase s...		Lus10000525 [exp]	2.4	0.8968
					Lus10001241 [exp]	8.9	0.8948
AT1G24120		ARL1	ARG1-like 1 (.1)		Lus10030827 [exp]	13.4	0.8923
AT5G53070			Ribosomal protein L9/RNase H1 ...		Lus10022383 [exp]	14.1	0.8889
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10002302 [exp]	14.4	0.8998
AT1G63380			NAD(P)-binding Rossmann-fold s...		Lus10006698 [exp]	19.4	0.8824
AT1G08845			Ribosomal L18p/L5e family prot...		Lus10001727 [exp]	19.4	0.8489
AT2G38450			unknown protein		Lus10001262 [exp]	22.8	0.8840
AT2G30710			Ypt/Rab-GAP domain of gyp1p su...		Lus10019370 [exp]	24.3	0.8406

Compare expression of checked genes

Lus10003137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.