Lus10003140 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50760 97 / 1e-25 SAUR-like auxin-responsive protein family (.1)
AT5G20810 72 / 3e-16 SAUR-like auxin-responsive protein family (.1.2)
AT3G12830 70 / 1e-15 SAUR-like auxin-responsive protein family (.1)
AT3G20220 69 / 1e-15 SAUR-like auxin-responsive protein family (.1)
AT3G43120 69 / 7e-15 SAUR-like auxin-responsive protein family (.1)
AT3G20210 71 / 1e-14 DELTAVPE, DELTA-VPE delta vacuolar processing enzyme (.1.2)
AT1G56150 66 / 1e-14 SAUR-like auxin-responsive protein family (.1)
AT2G24400 67 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT5G10990 66 / 7e-14 SAUR-like auxin-responsive protein family (.1)
AT1G75590 66 / 8e-14 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011332 318 / 3e-113 AT5G50760 99 / 3e-26 SAUR-like auxin-responsive protein family (.1)
Lus10034888 68 / 1e-14 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Lus10034507 67 / 2e-14 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 65 / 2e-13 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10012185 63 / 2e-13 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Lus10026977 65 / 3e-13 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10042374 64 / 4e-13 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10033161 64 / 4e-13 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10026297 64 / 5e-13 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G167400 143 / 5e-44 AT5G50760 100 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Potri.001G060400 134 / 1e-39 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Potri.012G102700 113 / 6e-32 AT5G50760 97 / 1e-25 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 72 / 1e-16 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 71 / 4e-16 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 71 / 2e-15 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.006G278100 68 / 9e-15 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 67 / 2e-14 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.008G003900 66 / 2e-14 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.009G127100 66 / 2e-14 AT5G18080 103 / 2e-30 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10003140 pacid=23170014 polypeptide=Lus10003140 locus=Lus10003140.g ID=Lus10003140.BGIv1.0 annot-version=v1.0
ATGGATCAACCCAAGAAAAAGGGCAACCTAATCAGCAAGACGTGGGAGAAGTCATGCAAGCTCCTCCTACTCCGTAAGAGGCCCTCGAGGACGGCCAGCT
TCTACACCGACGATGGCGAATATCCAAAACGGCGCCGTCGTGGTAAACGCCAGGTGGCGCCTGAAGGATGCTTCACGGTCTACGTGGGGCCGGAGAAGCA
GAGGTTTGTGGTGATGACCGAGTACGCTAACCACCCGATGTTCCGGGTCCTACTGGACGAAGCGGAGTCGGAGTTCGGGTACAACCCGGAAGGCCCGCTA
GTGCTTCCTTGCGAGGTTGACTACTTCTGGAAAGTTCTGATGGATATGGACAGTGAAGTCGAAGAAGAGGCAGCGGAGAAGGAAGAGCTTGTTCGTCAAA
AGTCCTGTGGACGGTTTGCTAAGGCGGCTGGCAGTTATAACGGTTCTTATTACCACCGTCATCTCATCTGCCCGTCGCCGTTGATGGCTCTCAACCGTTA
CGTCATCTGA
AA sequence
>Lus10003140 pacid=23170014 polypeptide=Lus10003140 locus=Lus10003140.g ID=Lus10003140.BGIv1.0 annot-version=v1.0
MDQPKKKGNLISKTWEKSCKLLLLRKRPSRTASFYTDDGEYPKRRRRGKRQVAPEGCFTVYVGPEKQRFVVMTEYANHPMFRVLLDEAESEFGYNPEGPL
VLPCEVDYFWKVLMDMDSEVEEEAAEKEELVRQKSCGRFAKAAGSYNGSYYHRHLICPSPLMALNRYVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G50760 SAUR-like auxin-responsive pro... Lus10003140 0 1
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10032220 1.4 0.9579
AT4G27290 S-locus lectin protein kinase ... Lus10016871 2.2 0.9586
AT1G20640 NLP4 Plant regulator RWP-RK family ... Lus10014429 2.8 0.9506
AT5G05340 Peroxidase superfamily protein... Lus10034207 3.0 0.9510
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Lus10035621 4.6 0.9465
AT5G58630 unknown protein Lus10040661 4.9 0.9363
AT1G51340 MATE efflux family protein (.1... Lus10026303 5.5 0.9479
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10014108 6.0 0.9374
AT5G55180 O-Glycosyl hydrolases family 1... Lus10018306 8.7 0.9279
Lus10033269 8.9 0.9480

Lus10003140 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.