Lus10003141 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02000 71 / 2e-16 ROXY1 Thioredoxin superfamily protein (.1)
AT5G14070 71 / 3e-16 ROXY2 Thioredoxin superfamily protein (.1)
AT3G21460 62 / 2e-13 Glutaredoxin family protein (.1)
AT4G33040 61 / 1e-12 Thioredoxin superfamily protein (.1)
AT2G47870 58 / 1e-11 Thioredoxin superfamily protein (.1)
AT3G62950 54 / 2e-10 Thioredoxin superfamily protein (.1)
AT4G15660 54 / 4e-10 Thioredoxin superfamily protein (.1)
AT4G15670 52 / 1e-09 Thioredoxin superfamily protein (.1)
AT2G47880 52 / 2e-09 Glutaredoxin family protein (.1)
AT3G62960 52 / 2e-09 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011333 180 / 5e-59 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10041538 72 / 8e-17 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10002887 66 / 6e-15 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Lus10033965 66 / 6e-15 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Lus10035183 66 / 2e-14 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10012815 64 / 5e-14 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Lus10040899 58 / 9e-12 AT2G30540 140 / 5e-45 Thioredoxin superfamily protein (.1)
Lus10023295 59 / 1e-11 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Lus10005937 57 / 3e-11 AT2G47880 138 / 7e-44 Glutaredoxin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G060600 91 / 3e-24 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.003G167000 88 / 2e-23 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.001G325800 86 / 2e-22 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.010G021800 64 / 5e-14 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.008G214500 64 / 5e-14 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.006G226900 58 / 2e-11 AT4G33040 184 / 8e-61 Thioredoxin superfamily protein (.1)
Potri.014G134300 57 / 2e-11 AT2G30540 157 / 1e-51 Thioredoxin superfamily protein (.1)
Potri.002G208400 57 / 2e-11 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1)
Potri.008G214800 56 / 9e-11 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
Potri.008G214600 54 / 4e-10 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10003141 pacid=23170010 polypeptide=Lus10003141 locus=Lus10003141.g ID=Lus10003141.BGIv1.0 annot-version=v1.0
ATGTATACACAGCAGTACTACCCCGACCTTCACCATTATCGCTACAACCCCTCCTCGGACCACCACCACCACCATCAGATGAAGCAGCCAGCATACTACG
ATGCCGCAGTGCCAGACCCGCTGGAGAAGGTGGCGAGGCTGGCGGCGGAGAGCGCGGTGGTGATATTCAGCCTCAGCACGTGCTGCATGTGCCATGCTGT
CAAGCGGCTCTTTTGCAGCATGGGAGTCAGCCCCAACGTGATAGAGCTCGACAACCACCCACGTGGCAGGGAGCTTGAACGCGCATTGCTCCGCCTCCAC
GACGTTACCAATACTACAAGCTACGGCGGCACGCGACGTCACCAACACTACCAGCTACGGCGGAGCAGCGTCATCCGCCGTTCCATTGGTTTTCATCGGC
GGGAAGCTCATCGGAGCGATGGATAG
AA sequence
>Lus10003141 pacid=23170010 polypeptide=Lus10003141 locus=Lus10003141.g ID=Lus10003141.BGIv1.0 annot-version=v1.0
MYTQQYYPDLHHYRYNPSSDHHHHHQMKQPAYYDAAVPDPLEKVARLAAESAVVIFSLSTCCMCHAVKRLFCSMGVSPNVIELDNHPRGRELERALLRLH
DVTNTTSYGGTRRHQHYQLRRSSVIRRSIGFHRREAHRSDG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10003141 0 1
AT5G26330 Cupredoxin superfamily protein... Lus10010533 4.6 0.9654
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10014528 5.7 0.9750
AT1G03840 C2H2ZnF MGP Magpie, C2H2 and C2HC zinc fin... Lus10042626 5.7 0.9671
AT2G33510 AtCFL1 unknown protein Lus10001804 8.3 0.9344
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10005537 8.9 0.9747
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10011333 9.0 0.9744
AT5G39760 ZF_HD ATHB23, ZHD10 ZINC FINGER HOMEODOMAIN 10, ho... Lus10030473 9.8 0.9649
AT1G31310 Trihelix hydroxyproline-rich glycoprote... Lus10040629 9.8 0.9744
AT1G72570 AP2_ERF Integrase-type DNA-binding sup... Lus10015653 13.9 0.9727
AT2G02540 ZF_HD ATHB21, ZFHD4, ... ZINC FINGER HOMEODOMAIN 3, ZIN... Lus10010693 14.1 0.9736

Lus10003141 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.