Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42000 193 / 1e-65 ORMDL family protein (.1.2) AT1G01230 186 / 4e-62 ORMDL family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017314 [exp] 226 / 3e-78 AT5G42000 197 / 3e-66 ORMDL family protein (.1.2) Lus10033219 [exp] 214 / 6e-73 AT5G42000 271 / 5e-95 ORMDL family protein (.1.2) Lus10023031 [exp] 211 / 4e-72 AT5G42000 270 / 1e-94 ORMDL family protein (.1.2) Lus10005980 [exp] 185 / 1e-61 AT1G01230 295 / 1e-104 ORMDL family protein (.1) Lus10030232 [exp] 187 / 1e-56 AT1G09880 661 / 0.0 Rhamnogalacturonate lyase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G144600 [exp] 200 / 1e-67 AT5G42000 281 / 8e-99 ORMDL family protein (.1.2) Potri.001G086300 [exp] 191 / 3e-64 AT5G42000 273 / 1e-95 ORMDL family protein (.1.2) Potri.014G101000 [exp] 188 / 7e-63 AT1G01230 285 / 3e-100 ORMDL family protein (.1) Potri.002G174400 [exp] 186 / 6e-62 AT1G01230 254 / 3e-88 ORMDL family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04061 [flax] [poplar] ORMDL ORMDL family
Representative CDS sequence Show only first row Show all	>Lus10003209 pacid=23155741 polypeptide=Lus10003209 locus=Lus10003209.g ID=Lus10003209.BGIv1.0 annot-version=v1.0 ATGTACGTGACAGCAGATCCGCCAACGGATGTGAATCGGAACACCGAGTGGTTCACCTATCCCGGCGTCTGGACTACCTACATCATCATCCTCTTCACCT CCTGGTTCATGGTCCTTTGCCTCTTCGGCTGCTCCCCCGGCACCGCTTGGACCGTCGTCCATCTCGCCCATTTCCTCGTTACATATCATTGTTTTCACTG GAAGAAGGGGACTCCTTTCGCGGACGACCAAGGTATCTACAATGGGTTGACTTGGTGGGAACAAATTGAGAACGGGAAGCAACTCACACGCAATAGGAAG TTTCTCACTGTTGTACCAGTTGTGCTGTGA
AA sequence Show only first row Show all	>Lus10003209 pacid=23155741 polypeptide=Lus10003209 locus=Lus10003209.g ID=Lus10003209.BGIv1.0 annot-version=v1.0 MYVTADPPTDVNRNTEWFTYPGVWTTYIIILFTSWFMVLCLFGCSPGTAWTVVHLAHFLVTYHCFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRK FLTVVPVVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42000			ORMDL family protein (.1.2)		Lus10003209 [exp]	0	1
AT2G31305		INH3	inhibitor-3 (.1)		Lus10018105 [exp]	1.4	0.7941
AT5G11090			serine-rich protein-related (....		Lus10001928 [exp]	1.7	0.7974
AT5G19080			RING/U-box superfamily protein...		Lus10034030 [exp]	4.9	0.7756
AT5G02420			unknown protein		Lus10038653 [exp]	5.5	0.7448
AT4G08455			BTB/POZ domain-containing prot...		Lus10042763 [exp]	8.2	0.7459
AT5G25280			serine-rich protein-related (....		Lus10008808 [exp]	9.5	0.7059
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Lus10042802 [exp]	13.4	0.7216
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Lus10029773 [exp]	13.7	0.7260
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10018222 [exp]	15.7	0.6963
AT3G52190		AtPHF1, PHF1	phosphate transporter traffic ...		Lus10017451 [exp]	18.1	0.7367

Compare expression of checked genes

Lus10003209 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.