Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10750 92 / 6e-24 Phosphoenolpyruvate carboxylase family protein (.1) AT4G24080 71 / 1e-16 ALL1 aldolase like (.1) AT4G24070 55 / 1e-11 carbon-carbon lyases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017323 [exp] 87 / 1e-21 AT4G10750 440 / 7e-155 Phosphoenolpyruvate carboxylase family protein (.1) Lus10000224 [exp] 82 / 5e-20 AT4G10750 409 / 3e-143 Phosphoenolpyruvate carboxylase family protein (.1) Lus10000223 [exp] 74 / 2e-18 AT4G10750 144 / 9e-43 Phosphoenolpyruvate carboxylase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G145700 [exp] 79 / 4e-19 AT4G10750 435 / 2e-153 Phosphoenolpyruvate carboxylase family protein (.1) Potri.001G084900 [exp] 0 / 1 AT4G10750 211 / 3e-08 Phosphoenolpyruvate carboxylase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003220 pacid=23155762 polypeptide=Lus10003220 locus=Lus10003220.g ID=Lus10003220.BGIv1.0 annot-version=v1.0 ATGGGCTACTTAAACGACCCGGGCCAGCAGAAAGTGAAGGAGATGATAAGCGAGGCGGAGGAGACAGTATTGGGCCGGATTAGAAGTAAAGGATTTGGAG CCTATTTGGCCGGGTTTGCGATGGGAAAAGATGGGCTTGGGCCGGAGGAGCTGAGAAAGAAGGGATATCACATGGTGTGCGGGGCCGCCGATGTGAGCTT GTTCAGGGACGCCGCTGTCGGCGACGTGAACAGGTTTAGAGTGTCCCAGTAG
AA sequence Show only first row Show all	>Lus10003220 pacid=23155762 polypeptide=Lus10003220 locus=Lus10003220.g ID=Lus10003220.BGIv1.0 annot-version=v1.0 MGYLNDPGQQKVKEMISEAEETVLGRIRSKGFGAYLAGFAMGKDGLGPEELRKKGYHMVCGAADVSLFRDAAVGDVNRFRVSQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10750			Phosphoenolpyruvate carboxylas...		Lus10003220 [exp]	0	1
AT1G07710			Ankyrin repeat family protein ...		Lus10015224 [exp]	2.8	0.7828
AT3G06890			unknown protein		Lus10006514 [exp]	3.7	0.7510
AT2G27770			Plant protein of unknown funct...		Lus10009405 [exp]	4.0	0.7384
AT5G47760		ATPK5, ATPGLP2	2-phosphoglycolate phosphatase...		Lus10039102 [exp]	4.2	0.7230
AT1G07710			Ankyrin repeat family protein ...		Lus10005432 [exp]	8.3	0.7508
AT5G19630			alpha/beta-Hydrolases superfam...		Lus10004187 [exp]	15.5	0.6500
AT5G21105			Plant L-ascorbate oxidase (.1....		Lus10025538 [exp]	15.9	0.7320
AT2G01080			Late embryogenesis abundant (L...		Lus10036163 [exp]	18.1	0.7244
AT5G47330			alpha/beta-Hydrolases superfam...		Lus10004757 [exp]	19.8	0.6974
AT1G78560			Sodium Bile acid symporter fam...		Lus10035803 [exp]	25.1	0.6864

Compare expression of checked genes

Lus10003220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.