Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46860 42 / 3e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38870 40 / 1e-05 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 38 / 0.0002 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43580 36 / 0.0005 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035626 [exp] 164 / 2e-54 AT2G38900 43 / 8e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10024370 [exp] 98 / 5e-28 AT2G38870 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10010859 [exp] 97 / 2e-27 AT2G38900 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10018783 [exp] 55 / 3e-11 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10032655 [exp] 53 / 2e-09 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10043097 [exp] 53 / 3e-09 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10018784 [exp] 45 / 2e-07 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10002732 [exp] 43 / 1e-06 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 40 / 2e-05 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G088500 [exp] 91 / 6e-25 ND / Potri.006G088700 [exp] 91 / 9e-25 ND / Potri.006G088664 [exp] 90 / 9e-25 ND / Potri.006G088616 [exp] 91 / 1e-24 ND / Potri.011G110100 [exp] 52 / 3e-10 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110400 [exp] 52 / 4e-10 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.006G212000 [exp] 49 / 7e-09 AT2G38870 81 / 5e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075600 [exp] 49 / 7e-09 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 48 / 8e-09 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075501 [exp] 45 / 8e-08 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10003225 pacid=23182531 polypeptide=Lus10003225 locus=Lus10003225.g ID=Lus10003225.BGIv1.0 annot-version=v1.0 ATGGCGGACGGGAACAATCAGAACAACTGTACAGCGGAGGAGCAACAACCTTCAGAGCCAAATCAACCCTCAGAGCCAAAGGCAATCCCAGGGTTTCCGA GGAGAAGCAAATCGCAGTGGCCCGAGTTAGTTGGGCTACCTGCTGAAGAAGCCGAAGCCAAGATTAAAGAAGACATGGAAGGCGCTCTAGTCCACGTGGT TCCTCCTAATCACTTCGTTACCATGGATTTCCGCCGGAATAGGGTCCGGCTTTATGTAGATTCCGAGGGCAAGATCGCCAGAGCCCCTATAATTGGCTGA
AA sequence Show only first row Show all	>Lus10003225 pacid=23182531 polypeptide=Lus10003225 locus=Lus10003225.g ID=Lus10003225.BGIv1.0 annot-version=v1.0 MADGNNQNNCTAEEQQPSEPNQPSEPKAIPGFPRRSKSQWPELVGLPAEEAEAKIKEDMEGALVHVVPPNHFVTMDFRRNRVRLYVDSEGKIARAPIIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38900			Serine protease inhibitor, pot...		Lus10003225 [exp]	0	1
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Lus10014329 [exp]	1.4	0.9145
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10018672 [exp]	2.0	0.8755
AT2G38900			Serine protease inhibitor, pot...		Lus10035626 [exp]	2.0	0.9154
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10037296 [exp]	4.8	0.8370
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10014439 [exp]	6.9	0.8159
AT1G78790			unknown protein		Lus10042782 [exp]	8.5	0.8489
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10026070 [exp]	9.5	0.8646
AT2G32260		ATCCT1	phosphorylcholine cytidylyltra...		Lus10003808 [exp]	11.1	0.8775
AT3G22550			Protein of unknown function (D...		Lus10035894 [exp]	11.4	0.8185
AT5G35180			Protein of unknown function (D...		Lus10040011 [exp]	12.2	0.8212

Compare expression of checked genes

Lus10003225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.