Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04720 155 / 7e-49 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006557 [exp] 226 / 1e-77 AT3G04720 191 / 2e-62 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003265 [exp] 177 / 5e-58 AT3G04720 202 / 8e-67 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003264 [exp] 174 / 5e-57 AT3G04720 181 / 1e-58 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006552 [exp] 173 / 4e-56 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006556 [exp] 162 / 2e-52 AT3G04720 186 / 1e-60 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10020252 [exp] 112 / 1e-32 AT3G04720 135 / 4e-40 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003588 [exp] 110 / 8e-32 AT3G04720 128 / 1e-37 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10001774 [exp] 109 / 2e-31 AT3G04720 125 / 2e-36 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003266 [exp] 94 / 4e-26 AT3G04720 89 / 2e-23 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G041700 [exp] 168 / 2e-54 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.005G054000 [exp] 166 / 1e-53 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041900 [exp] 165 / 3e-53 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041600 [exp] 162 / 6e-52 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF00967 [flax] [poplar] Barwin Barwin family
Representative CDS sequence Show only first row Show all	>Lus10003262 pacid=23147849 polypeptide=Lus10003262 locus=Lus10003262.g ID=Lus10003262.BGIv1.0 annot-version=v1.0 ATGTATCCATCTAGAATGAAAAATTTCGCTGGTGCTTACTGTGCAACCTGGGACGCCAAGAAGCCCCTCGCTTGGCGCAAGAAGTATGGCTGGACCGCCT TCTGTGGGCCAGTCGGACCCCGCGGCAGACCCTCTTGCGGCCGCTGCTTAAGGGTGACTAACAGGGGAACGAGAGCTCAAGCGATGGTGAGAATAGTGGA CCAGTGTAGCAATGGAGGTCTGGATCTGGACATCAATATATTCAGAAAAATTGATACCAACGGAAAAGGATATGCTCGAGGGCACCTCATGGTTGACTAT CAGTTCGTCAACTGCCGTGACAAGAACATTGAAACTATTGCTTTGGAACATGAAAGTACAGCATAA
AA sequence Show only first row Show all	>Lus10003262 pacid=23147849 polypeptide=Lus10003262 locus=Lus10003262.g ID=Lus10003262.BGIv1.0 annot-version=v1.0 MYPSRMKNFAGAYCATWDAKKPLAWRKKYGWTAFCGPVGPRGRPSCGRCLRVTNRGTRAQAMVRIVDQCSNGGLDLDINIFRKIDTNGKGYARGHLMVDY QFVNCRDKNIETIALEHESTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003262 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Lus10003072 [exp]	2.4	0.8928
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10039743 [exp]	7.5	0.8895
AT2G48020			Major facilitator superfamily ...		Lus10029629 [exp]	9.9	0.7308
AT2G02990		RNS1, ATRNS1	ribonuclease 1 (.1)		Lus10035881 [exp]	12.4	0.8069
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Lus10021664 [exp]	12.5	0.8143
AT4G34000	bZIP	AtABF3, ABF3, D...	DC3 PROMOTER-BINDING FACTOR 5,...		Lus10043386 [exp]	15.3	0.7641
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10018748 [exp]	16.0	0.7803
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10039349 [exp]	18.1	0.8591
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10004781 [exp]	19.3	0.8364
AT4G23990		ATCSLG3	ARABIDOPSIS THALIANA CELLULOSE...		Lus10032415 [exp]	21.4	0.8521

Compare expression of checked genes

Lus10003262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.