Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04720 89 / 3e-23 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-related 4 (.1) AT2G39050 86 / 2e-21 ArathEULS3 Euonymus lectin S3, hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006552 [exp] 121 / 9e-36 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006551 [exp] 120 / 5e-34 AT2G39050 263 / 1e-86 Euonymus lectin S3, hydroxyproline-rich glycoprotein family protein (.1) Lus10003264 [exp] 99 / 8e-28 AT3G04720 181 / 1e-58 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003265 [exp] 100 / 1e-27 AT3G04720 202 / 8e-67 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006557 [exp] 99 / 1e-27 AT3G04720 191 / 2e-62 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003262 [exp] 94 / 5e-26 AT3G04720 154 / 2e-48 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006556 [exp] 87 / 5e-23 AT3G04720 186 / 1e-60 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006553 [exp] 75 / 1e-18 AT3G04720 81 / 2e-20 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003588 [exp] 60 / 3e-12 AT3G04720 128 / 1e-37 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G041700 [exp] 105 / 1e-29 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041900 [exp] 103 / 3e-29 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.005G054000 [exp] 100 / 5e-28 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041600 [exp] 94 / 2e-25 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.019G031500 [exp] 94 / 3e-24 AT2G39050 243 / 7e-79 Euonymus lectin S3, hydroxyproline-rich glycoprotein family protein (.1) Potri.013G054100 [exp] 91 / 6e-23 AT2G39050 253 / 2e-82 Euonymus lectin S3, hydroxyproline-rich glycoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF00967 [flax] [poplar] Barwin Barwin family
Representative CDS sequence Show only first row Show all	>Lus10003266 pacid=23147844 polypeptide=Lus10003266 locus=Lus10003266.g ID=Lus10003266.BGIv1.0 annot-version=v1.0 ATGATGGCTCGAGCCGATCCTCATGATCCCTGCCAGAACTGGTTCAAGGATGAGAAGTACAGCACTAGAGTGAAGGATGAGGAAGGGTGTCCTTGCTTTG CCTTGGTCAATAAGGCTACTGGTCAGGCTATCAAGCACTCCGTTGGAGACACTAAACCTGTGACGAACAAAGGAACCGGAGCACAAGAGACGGTGAGAAT TGTTGACCAGTGTAGCAACGGAGGTCTGGATCTGGACGTTGGTGTTTTTAAGAGGATCGATACCGACGGAAGAGGAAATGCTCAAGGCCACATCATGGTT GACTATCAATTCGTTAACTGTGGAGACTAA
AA sequence Show only first row Show all	>Lus10003266 pacid=23147844 polypeptide=Lus10003266 locus=Lus10003266.g ID=Lus10003266.BGIv1.0 annot-version=v1.0 MMARADPHDPCQNWFKDEKYSTRVKDEEGCPCFALVNKATGQAIKHSVGDTKPVTNKGTGAQETVRIVDQCSNGGLDLDVGVFKRIDTDGRGNAQGHIMV DYQFVNCGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003266 [exp]	0	1
AT3G09520		ATEXO70H4	exocyst subunit exo70 family p...		Lus10025291 [exp]	1.0	0.9579
AT3G25250		AtOXI1, OXI1, A...	oxidative signal-inducible1, A...		Lus10025882 [exp]	2.4	0.9452
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10005746 [exp]	5.1	0.9383
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10025430 [exp]	6.7	0.9491
AT2G42360			RING/U-box superfamily protein...		Lus10005275 [exp]	10.1	0.9210
AT1G74360			Leucine-rich repeat protein ki...		Lus10003477 [exp]	14.3	0.9466
AT2G43840		UGT74F1	UDP-glycosyltransferase 74 F1 ...		Lus10014148 [exp]	17.7	0.9550
AT2G01340		At17.1	unknown protein		Lus10016709 [exp]	20.6	0.9461
AT3G05170			Phosphoglycerate mutase family...		Lus10031518 [exp]	21.3	0.9452
AT1G73480			alpha/beta-Hydrolases superfam...		Lus10009679 [exp]	27.7	0.9415

Compare expression of checked genes

Lus10003266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.