Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G33340 155 / 3e-45 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT1G64830 136 / 3e-38 Eukaryotic aspartyl protease family protein (.1) AT2G35615 132 / 8e-37 Eukaryotic aspartyl protease family protein (.1) AT1G31450 116 / 8e-31 Eukaryotic aspartyl protease family protein (.1) AT2G28010 96 / 4e-23 Eukaryotic aspartyl protease family protein (.1) AT2G28030 91 / 2e-21 Eukaryotic aspartyl protease family protein (.1) AT2G03200 86 / 2e-19 Eukaryotic aspartyl protease family protein (.1) AT2G28220 84 / 1e-18 Eukaryotic aspartyl protease family protein (.1) AT2G28040 83 / 1e-18 Eukaryotic aspartyl protease family protein (.1) AT4G16563 71 / 2e-14 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018825 [exp] 248 / 6e-81 AT5G33340 432 / 1e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024905 [exp] 194 / 2e-63 AT5G33340 191 / 2e-59 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10041151 [exp] 196 / 5e-61 AT5G33340 445 / 1e-154 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022912 [exp] 194 / 2e-60 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024903 [exp] 194 / 4e-60 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10023445 [exp] 194 / 6e-60 AT5G33340 448 / 9e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10040325 [exp] 192 / 1e-59 AT5G33340 451 / 5e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024910 [exp] 192 / 2e-59 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10003280 [exp] 164 / 5e-49 AT2G35615 314 / 1e-103 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G114400 [exp] 154 / 4e-45 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G087900 [exp] 137 / 2e-38 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G105300 [exp] 119 / 1e-31 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1) Potri.001G306200 [exp] 102 / 1e-25 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 99 / 3e-24 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.002G171700 [exp] 75 / 1e-15 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.014G099400 [exp] 68 / 3e-13 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.012G118000 [exp] 66 / 7e-13 AT5G45120 575 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.002G104600 [exp] 66 / 9e-13 AT1G09750 531 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.015G113100 [exp] 66 / 2e-12 AT5G45120 588 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [flax] [poplar] Peptidase_AA PF00026 [flax] [poplar] Asp Eukaryotic aspartyl protease
Representative CDS sequence Show only first row Show all	>Lus10003281 pacid=23147852 polypeptide=Lus10003281 locus=Lus10003281.g ID=Lus10003281.BGIv1.0 annot-version=v1.0 ATGAATTCCGGTGAAAATGCTGTCGTTTTAGGGGGTATTTCGACCCCGATGATTTTGGACCCCACAAAGCCTACTTTCTACTTTCTTAAGTTGGAAGGTG TGAGCATTGGGGAAAAGAGAATACCATTCCAATTAGGATCATCATCTTTCGGATCTTCTGATGGGAAAGGGAACATCATCATCGATTCCAGTACAACGCT CACAATGCTCCCCACAGAGTTCTTTTCCCAAGTATCGTATGCCGTTGAGAGTCAGATTGTTGACGCGAAGAAAGTGGAGGACCCGCAAGGCTATTTGAGC CTTTGCTACGAGGTCGTGAGTGGTCTCGATGTTTCTCGTATCACGGTGCATTTTGAGGGTGCTGACGTGGAGTTGACTCGGTCAAATGTTTTCATCCAGA TCAGCAATGCGGTAACGTGTTTGGCATTTTATCTGAGCGACGATGCTACGATTTATGGCAACATGGCGCAACAGAACTTCCTCATTGTCTATGACATTCA AAAGAGGACTCTATCCATCAAGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTTAA
AA sequence Show only first row Show all	>Lus10003281 pacid=23147852 polypeptide=Lus10003281 locus=Lus10003281.g ID=Lus10003281.BGIv1.0 annot-version=v1.0 MNSGENAVVLGGISTPMILDPTKPTFYFLKLEGVSIGEKRIPFQLGSSSFGSSDGKGNIIIDSSTTLTMLPTEFFSQVSYAVESQIVDAKKVEDPQGYLS LCYEVVSGLDVSRITVHFEGADVELTRSNVFIQISNAVTCLAFYLSDDATIYGNMAQQNFLIVYDIQKRTLSIKXXXXXXXXXXXXXXXXXXXXXXXS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10003281 [exp]	0	1
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	2.0	1.0000
					Lus10033149 [exp]	2.8	1.0000
AT1G75660		AtXRN3, XRN3	5'-3' exoribonuclease 3 (.1)		Lus10005213 [exp]	3.0	0.9900
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	3.9	1.0000
AT3G14040			Pectin lyase-like superfamily ...		Lus10023364 [exp]	4.5	1.0000
					Lus10026868 [exp]	4.9	0.9548
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027028 [exp]	6.3	1.0000
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10006200 [exp]	6.9	1.0000
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020441 [exp]	6.9	1.0000
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	7.5	1.0000

Compare expression of checked genes

Lus10003281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.