Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01470 368 / 5e-130 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT2G36830 332 / 7e-116 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT3G26520 320 / 3e-111 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT1G17810 258 / 1e-86 BETA-TIP beta-tonoplast intrinsic protein (.1) AT1G73190 254 / 5e-85 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT5G47450 250 / 1e-83 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT3G16240 243 / 1e-80 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT4G17340 229 / 1e-75 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT2G25810 219 / 2e-71 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT3G47440 169 / 1e-51 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021510 [exp] 345 / 4e-121 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10022611 [exp] 344 / 1e-120 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 340 / 3e-119 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10040863 [exp] 334 / 1e-116 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1) Lus10023913 [exp] 322 / 5e-112 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10014411 [exp] 320 / 3e-111 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10018256 [exp] 261 / 6e-88 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1) Lus10040652 [exp] 256 / 6e-86 AT1G17810 367 / 2e-129 beta-tonoplast intrinsic protein (.1) Lus10036187 [exp] 253 / 8e-85 AT1G73190 382 / 4e-135 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G209900 [exp] 353 / 2e-124 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.008G050700 [exp] 342 / 9e-120 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.001G235300 [exp] 335 / 3e-117 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1) Potri.009G027200 [exp] 325 / 4e-113 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1) Potri.006G121700 [exp] 322 / 5e-112 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.016G098200 [exp] 321 / 1e-111 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.004G216500 [exp] 317 / 1e-109 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1) Potri.009G005400 [exp] 310 / 4e-107 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.017G154800 [exp] 270 / 2e-91 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1) Potri.018G152100 [exp] 265 / 2e-89 AT1G17810 350 / 8e-123 beta-tonoplast intrinsic protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10003288 pacid=23169877 polypeptide=Lus10003288 locus=Lus10003288.g ID=Lus10003288.BGIv1.0 annot-version=v1.0 ATGCCCATCTACAGAATCGCCATCGGAAATCCGGGAGAGGCGAGGGAGCCCGACGCAATCAGGGCCGCCATGGCTGAATTCTTCTCCATGCTCATCTTCG TTTTCGCCGGCCAAGGCTCCGGCATGGCTATTAGCAAGATAACCGATAATGGACCGGCAGCACCCGCGGGACTAATAGCTGCATCTTTATCCCATGCATT TGCACTTTTTGTGGCGGTTTCCGCCGCGGCAAATACCTCTGGCGGTCACATCAATCCGGCGGTGACATTTGGGGCACTCATAGGTGGGAACATAACTTTG TTGAGAGGGATTCTATATTGGATTGCTCAATTGTTGGGCTCAGTCGTCGCTTGCTTGCTCCTCAAGTATGCCACCGGTGGATTGGAAATATCAGCAATGG CGATATCAGAAGGAATGACGAGAGGGAACGCGTTGGTGTTGGAGATGGTGATGACATTTGGGTTGGTGTATACGGTGTACGCAACGGCGGTGGATCCGAA GAGAGGCAAGGTGGGAGTTGTGGCGCCGATTGCAATAGGGTTCATAGTGGGTGCTAATATACTAGTAGGAGGTGCATTTGACGGTGCATCCATGAATCCT GCACTCTCATTTGGCCCTGCGCTTGTTAGCTGGACTTGGACTCACCATTGGGTCTACTGGCTCGGTCCCTTTATTGGTTCGGCAATTGCTGCAGTTGTCT ATGACAATGTCTTCATGGCTGCTGATTCAACTTATGAACCAATTCCTGCTCGCCATTATTAA
AA sequence Show only first row Show all	>Lus10003288 pacid=23169877 polypeptide=Lus10003288 locus=Lus10003288.g ID=Lus10003288.BGIv1.0 annot-version=v1.0 MPIYRIAIGNPGEAREPDAIRAAMAEFFSMLIFVFAGQGSGMAISKITDNGPAAPAGLIAASLSHAFALFVAVSAAANTSGGHINPAVTFGALIGGNITL LRGILYWIAQLLGSVVACLLLKYATGGLEISAMAISEGMTRGNALVLEMVMTFGLVYTVYATAVDPKRGKVGVVAPIAIGFIVGANILVGGAFDGASMNP ALSFGPALVSWTWTHHWVYWLGPFIGSAIAAVVYDNVFMAADSTYEPIPARHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10003288 [exp]	0	1
AT1G65680		ATHEXPBETA1.4, ...	expansin B2 (.1)		Lus10027223 [exp]	1.0	0.8831
AT2G02990		RNS1, ATRNS1	ribonuclease 1 (.1)		Lus10035881 [exp]	17.9	0.7760
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10000045 [exp]	21.7	0.8208
AT4G24000		ATCSLG2	ARABIDOPSIS THALIANA CELLULOSE...		Lus10032416 [exp]	22.6	0.8168
AT4G37990		CAD-B2, ATCAD8,...	CINNAMYL-ALCOHOL DEHYDROGENASE...		Lus10038536 [exp]	25.0	0.7988
AT2G26730			Leucine-rich repeat protein ki...		Lus10002360 [exp]	27.1	0.6795
AT1G14220			Ribonuclease T2 family protein...		Lus10035882 [exp]	27.5	0.7616
AT3G53010			Domain of unknown function (DU...		Lus10042635 [exp]	37.1	0.7200
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10019669 [exp]	41.9	0.7582
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10036959 [exp]	55.2	0.6871

Compare expression of checked genes

Lus10003288 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.