Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55240 82 / 3e-22 Plant protein 1589 of unknown function (.1) AT3G28990 67 / 1e-16 Plant protein 1589 of unknown function (.1) AT5G02580 64 / 3e-15 Plant protein 1589 of unknown function (.1.2) AT1G10657 47 / 1e-08 Plant protein 1589 of unknown function (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030322 [exp] 132 / 2e-42 AT3G55240 83 / 1e-22 Plant protein 1589 of unknown function (.1) Lus10025300 [exp] 62 / 3e-14 AT5G02580 115 / 5e-35 Plant protein 1589 of unknown function (.1.2) Lus10024432 [exp] 61 / 1e-13 AT5G02580 112 / 1e-33 Plant protein 1589 of unknown function (.1.2) Lus10031001 [exp] 37 / 0.0002 AT3G10250 392 / 3e-137 Plant protein 1589 of unknown function (.1.2) Lus10035397 [exp] 37 / 0.0004 AT3G23270 526 / 2e-171 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G211500 [exp] 94 / 4e-27 AT3G55240 113 / 3e-34 Plant protein 1589 of unknown function (.1) Potri.006G213500 [exp] 67 / 2e-16 AT5G02580 96 / 2e-27 Plant protein 1589 of unknown function (.1.2) Potri.008G189100 [exp] 57 / 2e-12 AT1G10657 122 / 8e-38 Plant protein 1589 of unknown function (.1.2.3.4) Potri.010G042300 [exp] 53 / 9e-11 AT1G10657 119 / 1e-36 Plant protein 1589 of unknown function (.1.2.3.4) Potri.015G019500 [exp] 40 / 2e-05 AT3G61700 161 / 1e-46 Plant protein 1589 of unknown function (.1.2) Potri.012G001700 [exp] 36 / 0.0007 AT2G46420 165 / 3e-48 Plant protein 1589 of unknown function (.1.2) Potri.006G041200 [exp] 36 / 0.0009 AT3G10250 396 / 4e-139 Plant protein 1589 of unknown function (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09713 [flax] [poplar] A_thal_3526 Plant protein 1589 of unknown function (A_thal_3526)
Representative CDS sequence Show only first row Show all	>Lus10003293 pacid=23169870 polypeptide=Lus10003293 locus=Lus10003293.g ID=Lus10003293.BGIv1.0 annot-version=v1.0 ATGGAGGCTCTCTCTAAGCATGCAGACATCAAACCTGTCATCACCTCCACTGTGTGGAATGAACTGGAGAAAGAGAACAAAGGATTCTTTGAAGCGTATG CAGAATCAAAGAGCAAAGATGGAAGGATGACAGAGGAAGAAACAAGTGCGATGATAAGGAAGATGATAACCACTGAATCTTCCAAAAATGATTCCGAGGA CTGA
AA sequence Show only first row Show all	>Lus10003293 pacid=23169870 polypeptide=Lus10003293 locus=Lus10003293.g ID=Lus10003293.BGIv1.0 annot-version=v1.0 MEALSKHADIKPVITSTVWNELEKENKGFFEAYAESKSKDGRMTEEETSAMIRKMITTESSKNDSED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55240			Plant protein 1589 of unknown ...		Lus10003293 [exp]	0	1
AT1G32583			unknown protein		Lus10001911 [exp]	1.7	0.8814
AT1G54570			Esterase/lipase/thioesterase f...		Lus10033848 [exp]	6.5	0.7969
AT3G22210			unknown protein		Lus10003811 [exp]	6.8	0.8609
AT2G45850	AT-hook		AT hook motif DNA-binding fami...		Lus10030381 [exp]	9.6	0.8345
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10006169 [exp]	10.2	0.7817
AT3G49250		IDN1, DMS3	INVOLVED IN DE NOVO 1, defecti...		Lus10030244 [exp]	11.0	0.8058
AT3G26310		CYP71B35	"cytochrome P450, family 71, s...		Lus10006443 [exp]	11.5	0.8182
AT3G28480			Oxoglutarate/iron-dependent ox...		Lus10014502 [exp]	11.8	0.8099
					Lus10019515 [exp]	11.9	0.8401
AT3G05870		APC11	anaphase-promoting complex/cyc...		Lus10031549 [exp]	12.0	0.8191

Compare expression of checked genes

Lus10003293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.