Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39420 112 / 2e-31 alpha/beta-Hydrolases superfamily protein (.1) AT3G55180 111 / 5e-31 alpha/beta-Hydrolases superfamily protein (.1) AT2G39410 108 / 5e-30 alpha/beta-Hydrolases superfamily protein (.1.2) AT2G39400 104 / 3e-28 alpha/beta-Hydrolases superfamily protein (.1) AT3G62860 97 / 1e-25 alpha/beta-Hydrolases superfamily protein (.1) AT3G55190 96 / 5e-25 alpha/beta-Hydrolases superfamily protein (.1) AT2G47630 92 / 1e-23 alpha/beta-Hydrolases superfamily protein (.1) AT1G11090 86 / 2e-21 alpha/beta-Hydrolases superfamily protein (.1) AT5G14980 75 / 2e-17 alpha/beta-Hydrolases superfamily protein (.1) AT1G77420 73 / 1e-16 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040328 [exp] 136 / 9e-41 AT2G39420 468 / 2e-167 alpha/beta-Hydrolases superfamily protein (.1) Lus10023448 [exp] 136 / 1e-38 AT2G39420 459 / 2e-159 alpha/beta-Hydrolases superfamily protein (.1) Lus10007877 [exp] 96 / 7e-25 AT3G62860 501 / 2e-179 alpha/beta-Hydrolases superfamily protein (.1) Lus10030366 [exp] 94 / 2e-24 AT3G62860 400 / 2e-140 alpha/beta-Hydrolases superfamily protein (.1) Lus10011212 [exp] 86 / 4e-21 AT1G11090 430 / 2e-152 alpha/beta-Hydrolases superfamily protein (.1) Lus10018466 [exp] 84 / 7e-21 AT1G11090 382 / 1e-134 alpha/beta-Hydrolases superfamily protein (.1) Lus10025754 [exp] 74 / 6e-17 AT1G52760 564 / 0.0 lysophospholipase 2 (.1) Lus10035909 [exp] 73 / 2e-16 AT1G52760 568 / 0.0 lysophospholipase 2 (.1) Lus10028475 [exp] 70 / 8e-16 AT5G16120 338 / 7e-117 alpha/beta-Hydrolases superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G049000 [exp] 112 / 1e-31 AT2G39420 479 / 8e-172 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G212200 [exp] 107 / 3e-29 AT2G39420 462 / 4e-165 alpha/beta-Hydrolases superfamily protein (.1) Potri.002G204200 [exp] 93 / 6e-24 AT2G47630 493 / 2e-176 alpha/beta-Hydrolases superfamily protein (.1) Potri.014G129000 [exp] 92 / 1e-23 AT3G62860 499 / 5e-179 alpha/beta-Hydrolases superfamily protein (.1) Potri.011G046500 [exp] 87 / 1e-21 AT1G11090 461 / 1e-164 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G222300 [exp] 80 / 5e-19 AT5G19290 472 / 8e-169 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G124000 [exp] 76 / 1e-17 AT1G77420 510 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.008G040000 [exp] 76 / 2e-17 AT5G19290 507 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.003G059200 [exp] 75 / 4e-17 AT1G52760 560 / 0.0 lysophospholipase 2 (.1) Potri.001G175000 [exp] 74 / 6e-17 AT1G52760 554 / 0.0 lysophospholipase 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003304 pacid=23169856 polypeptide=Lus10003304 locus=Lus10003304.g ID=Lus10003304.BGIv1.0 annot-version=v1.0 ATGCCGTTTCTGCTTCTCCACGGGGAAGAAGATAGAGTGACAGATAAGTCGGTTAGCAAACAACTCTTCGATGTAGCGTCGAGCAAAGACAAGACAATCA AGTTGTACGACGGAATGTGGCATGGCCTGCTGTACGGGGAGACACCGGAGAATGTAGAGCTTGTGTTTAAGGACATTACATCATGGCTTGAGCAGAGAAC CAGCAGCAGTACTAGTACCAAGGTTTTGGATTCAACAATGTTGGAAATGGAGCAAAAGGTTGGGAATGACAAGAAGAATTGTCCCACCACAACTCCTGCT AGCTGA
AA sequence Show only first row Show all	>Lus10003304 pacid=23169856 polypeptide=Lus10003304 locus=Lus10003304.g ID=Lus10003304.BGIv1.0 annot-version=v1.0 MPFLLLHGEEDRVTDKSVSKQLFDVASSKDKTIKLYDGMWHGLLYGETPENVELVFKDITSWLEQRTSSSTSTKVLDSTMLEMEQKVGNDKKNCPTTTPA S

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39420			alpha/beta-Hydrolases superfam...		Lus10003304 [exp]	0	1
AT2G39420			alpha/beta-Hydrolases superfam...		Lus10003305 [exp]	2.4	0.9410
AT1G07700			Thioredoxin superfamily protei...		Lus10032343 [exp]	3.3	0.9465
AT3G17930			unknown protein		Lus10026379 [exp]	3.5	0.9417
AT1G18730		PnsB4, NDF6	Photosynthetic NDH subcomplex...		Lus10001645 [exp]	8.2	0.9404
AT1G12250			Pentapeptide repeat-containing...		Lus10024602 [exp]	9.5	0.9370
AT2G03420			unknown protein		Lus10036810 [exp]	10.8	0.9340
AT1G79040		PSBR	photosystem II subunit R (.1)		Lus10042461 [exp]	11.2	0.9384
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10013663 [exp]	13.2	0.9385
AT1G68010		ATHPR1, HPR	hydroxypyruvate reductase (.1....		Lus10014115 [exp]	14.4	0.9182
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10026006 [exp]	14.5	0.9380

Compare expression of checked genes

Lus10003304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.