Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09500 185 / 6e-62 Ribosomal L29 family protein (.1) AT5G02610 184 / 1e-61 Ribosomal L29 family protein (.1.2) AT2G39390 183 / 4e-61 Ribosomal L29 family protein (.1) AT3G55170 178 / 3e-59 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030314 [exp] 206 / 5e-70 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10019179 [exp] 199 / 2e-67 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 196 / 6e-66 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10025292 [exp] 189 / 2e-63 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10024437 [exp] 181 / 4e-60 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 154 / 1e-49 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G212300 [exp] 195 / 6e-66 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 188 / 3e-63 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2) Potri.006G214200 [exp] 188 / 5e-63 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.006G214100 [exp] 185 / 6e-62 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [flax] [poplar] Ribo_L29 PF00831 [flax] [poplar] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Lus10003306 pacid=23169873 polypeptide=Lus10003306 locus=Lus10003306.g ID=Lus10003306.BGIv1.0 annot-version=v1.0 ATGGCCAGAATCAAGGTCCACGAGCTGAGGCAGAAGAACAAATCCGACCTTTTGAACCAGTTGAAGGATCTCAAGGCTGAGCTCGCCCTCCTCCGCGTCG CTAAGGTCACTGGCGGCGCTCCTAACAAACTCTCCAAGATTAAGGTGGTGCGCTTGTCCATTGCCCAAGTCTTGACTGTGATTTCACAGAAGCAGAAAGC TGCTTTGCGAGAAGTCTACAAGAACAAGAAGCTCTTGCCTCTTGATCTTCGTCCTAAGAAAACTAGGGCCATTAGAAGAAGGCTTACAAAGCACCAGCAA TCATTGAAGACGGAGAGGGAGAAGAAGAGAGAAATGTACTTCCCAATGAGAAAGTATGCAATCAAGGTTTAA
AA sequence Show only first row Show all	>Lus10003306 pacid=23169873 polypeptide=Lus10003306 locus=Lus10003306.g ID=Lus10003306.BGIv1.0 annot-version=v1.0 MARIKVHELRQKNKSDLLNQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREVYKNKKLLPLDLRPKKTRAIRRRLTKHQQ SLKTEREKKREMYFPMRKYAIKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09500			Ribosomal L29 family protein ...		Lus10003306 [exp]	0	1
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10019681 [exp]	1.0	0.9537
AT3G13940			DNA binding;DNA-directed RNA p...		Lus10029818 [exp]	4.4	0.8862
AT2G44860			Ribosomal protein L24e family ...		Lus10020552 [exp]	4.6	0.9050
AT3G11500			Small nuclear ribonucleoprotei...		Lus10021342 [exp]	5.3	0.9122
AT4G14320			Zinc-binding ribosomal protein...		Lus10010195 [exp]	5.8	0.9347
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Lus10039931 [exp]	7.1	0.9002
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031974 [exp]	8.0	0.8884
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10014676 [exp]	8.7	0.9311
AT5G63010			Transducin/WD40 repeat-like su...		Lus10039042 [exp]	9.5	0.8876
AT2G46230			PIN domain-like family protein...		Lus10012649 [exp]	13.0	0.8883

Compare expression of checked genes

Lus10003306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.