Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01580 63 / 4e-13 B3 AP2/B3-like transcriptional factor family protein (.1) AT3G18960 61 / 5e-12 B3 AP2/B3-like transcriptional factor family protein (.1) AT3G18990 61 / 1e-11 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) AT5G66980 57 / 1e-10 B3 AP2/B3-like transcriptional factor family protein (.1) AT5G60130 57 / 2e-10 B3 AP2/B3-like transcriptional factor family protein (.1.2) AT1G49475 55 / 6e-10 B3 AP2/B3-like transcriptional factor family protein (.1) AT4G33280 52 / 8e-09 B3 REM16 AP2/B3-like transcriptional factor family protein (.1) AT3G53310 44 / 7e-06 B3 REM20 AP2/B3-like transcriptional factor family protein (.1) AT4G34400 42 / 3e-05 B3 AP2/B3-like transcriptional factor family protein (.1) AT3G06220 40 / 9e-05 B3 REM21 AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008460 [exp] 196 / 4e-66 AT4G01580 67 / 8e-15 AP2/B3-like transcriptional factor family protein (.1) Lus10016777 [exp] 77 / 2e-17 AT3G18990 115 / 3e-29 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10032389 [exp] 73 / 3e-17 AT3G18990 56 / 6e-10 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10023079 [exp] 74 / 6e-17 AT3G18990 69 / 3e-13 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10036045 [exp] 74 / 1e-16 AT3G18990 110 / 2e-27 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10010080 [exp] 73 / 5e-16 AT4G31680 75 / 8e-16 Transcriptional factor B3 family protein (.1) Lus10009688 [exp] 71 / 2e-15 AT3G18990 113 / 2e-28 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10026067 [exp] 69 / 7e-15 AT3G18990 76 / 6e-16 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10025534 [exp] 68 / 1e-14 AT3G18990 81 / 2e-18 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G191500 [exp] 73 / 3e-16 AT3G18990 189 / 5e-57 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.014G057101 [exp] 69 / 3e-15 AT3G18990 76 / 5e-16 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.004G147200 [exp] 67 / 6e-14 AT1G49480 110 / 5e-28 related to vernalization1 1 (.1) Potri.004G147000 [exp] 67 / 7e-14 AT3G18990 258 / 3e-83 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.004G230100 [exp] 66 / 2e-13 AT3G18990 161 / 1e-44 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.009G108500 [exp] 60 / 2e-11 AT3G18990 395 / 2e-137 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.004G146900 [exp] 57 / 1e-10 AT3G18990 353 / 6e-121 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.007G035700 [exp] 56 / 3e-10 AT4G01580 71 / 4e-15 AP2/B3-like transcriptional factor family protein (.1) Potri.002G129800 [exp] 55 / 1e-09 AT4G33280 159 / 9e-45 AP2/B3-like transcriptional factor family protein (.1) Potri.014G036800 [exp] 51 / 2e-08 AT3G18990 92 / 3e-20 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [flax] [poplar] DNA_b-psBarrel PF02362 [flax] [poplar] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Lus10003313 pacid=23177780 polypeptide=Lus10003313 locus=Lus10003313.g ID=Lus10003313.BGIv1.0 annot-version=v1.0 ATGGAGTTTCCAAGAGAAGAGGATAATGCCCAGCCACTCAAGTTCTTCAAGGTTATTCGTAGAGAATCCTTGAAAGATAAGAAATCAATGATTCCTAGGG ATTTCGTGAGACAATGTGGAAGGAACCTTCAAGGCAAGGCAACCCTTTTAGCCCCCAACGGTTTGATATGGGATATGAAGATTGTCAAGGATGATGGTGA TGATAGGAACGCCAAGTTTTGGTTCAAGAATGGGTGGCAAGCTTTTGCTGACAACTACTCCTTGTCCCATGGAGATTTTATGTCTTTTCAGTACAATGGT GGAAGCAACGCCAGCTCCCTTGAGTCTCCATCACCATATTTGATGAAAAGGAAGAGAAAGAGGGAGACTATCCATCAATGA
AA sequence Show only first row Show all	>Lus10003313 pacid=23177780 polypeptide=Lus10003313 locus=Lus10003313.g ID=Lus10003313.BGIv1.0 annot-version=v1.0 MEFPREEDNAQPLKFFKVIRRESLKDKKSMIPRDFVRQCGRNLQGKATLLAPNGLIWDMKIVKDDGDDRNAKFWFKNGWQAFADNYSLSHGDFMSFQYNG GSNASSLESPSPYLMKRKRKRETIHQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01580	B3		AP2/B3-like transcriptional fa...		Lus10003313 [exp]	0	1
					Lus10024691 [exp]	7.7	0.7705
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10008024 [exp]	8.7	0.7473
					Lus10008514 [exp]	10.7	0.7380
AT3G05610			Plant invertase/pectin methyle...		Lus10033466 [exp]	10.9	0.8064
AT1G70820			phosphoglucomutase, putative /...		Lus10020414 [exp]	11.3	0.7742
AT1G07520	GRAS		GRAS family transcription fact...		Lus10037757 [exp]	14.5	0.7725
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040324 [exp]	16.4	0.8006
AT5G26330			Cupredoxin superfamily protein...		Lus10006683 [exp]	16.7	0.7991
AT4G20990		ATACA4, ACA4	A. THALIANA ALPHA CARBONIC ANH...		Lus10031027 [exp]	17.5	0.7556
AT2G24370			Protein kinase protein with ad...		Lus10020185 [exp]	30.1	0.5986

Compare expression of checked genes

Lus10003313 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.