Lus10003316 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72810 62 / 3e-13 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
AT4G29840 61 / 4e-13 TS, MTO2 THREONINE SYNTHASE, METHIONINE OVER-ACCUMULATOR 2, Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008462 81 / 4e-20 AT4G29840 777 / 0.0 THREONINE SYNTHASE, METHIONINE OVER-ACCUMULATOR 2, Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
Lus10003317 79 / 2e-19 AT4G29840 858 / 0.0 THREONINE SYNTHASE, METHIONINE OVER-ACCUMULATOR 2, Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G199100 64 / 3e-14 AT1G72810 836 / 0.0 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
Potri.003G033200 61 / 7e-13 AT1G72810 833 / 0.0 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
PFAM info
Representative CDS sequence
>Lus10003316 pacid=23177781 polypeptide=Lus10003316 locus=Lus10003316.g ID=Lus10003316.BGIv1.0 annot-version=v1.0
ATGTTGATGGTTGCTAGGACCAAGAGGAATCAACAGATACCAAGTGTTGGGAAGGATATAAAAGACATGGCTTGTAGGTTTGCTAATCCACCTGTGAATG
TGAAGGCTGATTTTGGTTCAGTAATGGATGTTCTCAAGAAGTATCTGTGGAGTAATGCCCATTAG
AA sequence
>Lus10003316 pacid=23177781 polypeptide=Lus10003316 locus=Lus10003316.g ID=Lus10003316.BGIv1.0 annot-version=v1.0
MLMVARTKRNQQIPSVGKDIKDMACRFANPPVNVKADFGSVMDVLKKYLWSNAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72810 Pyridoxal-5'-phosphate-depende... Lus10003316 0 1
AT1G08260 ESD7, EMB142, E... TILTED 1, EARLY IN SHORT DAYS ... Lus10006269 12.6 0.7457
AT4G01860 Transducin family protein / WD... Lus10038045 16.1 0.7723
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023907 17.1 0.7297
AT2G13680 GLS2, ATGSL02, ... ARABIDOPSIS THALIANA GLUCAN SY... Lus10020893 21.3 0.7630
AT4G23540 ARM repeat superfamily protein... Lus10031065 24.9 0.7484
AT5G17430 AP2_ERF BBM BABY BOOM, Integrase-type DNA-... Lus10001185 29.1 0.7239
AT1G03190 ATXPD, UVH6 ULTRAVIOLET HYPERSENSITIVE 6, ... Lus10014662 31.0 0.7426
AT1G30960 GTP-binding family protein (.1... Lus10023046 33.4 0.7193
AT1G29630 5'-3' exonuclease family prote... Lus10002782 36.3 0.7182
AT4G30870 ATMUS81 ARABIDOPSIS THALIANA MMS AND U... Lus10039566 38.2 0.7050

Lus10003316 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.