Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35270 75 / 3e-17 NLP2 Plant regulator RWP-RK family protein (.1) AT1G20640 73 / 1e-16 NLP4 Plant regulator RWP-RK family protein (.1.2) AT2G17150 72 / 3e-16 NLP1 Plant regulator RWP-RK family protein (.1.2) AT1G76350 64 / 2e-13 NLP5 Plant regulator RWP-RK family protein (.1) AT4G24020 60 / 4e-12 NLP7 NIN like protein 7 (.1) AT4G38340 60 / 4e-12 NLP3 Plant regulator RWP-RK family protein (.1) AT3G59580 53 / 1e-09 NLP9 Plant regulator RWP-RK family protein (.1.2) AT1G64530 52 / 3e-09 NLP6 Plant regulator RWP-RK family protein (.1) AT2G43500 52 / 3e-09 NLP8 Plant regulator RWP-RK family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022621 [exp] 148 / 5e-44 AT2G17150 212 / 3e-60 Plant regulator RWP-RK family protein (.1.2) Lus10023930 [exp] 91 / 6e-23 AT4G35270 669 / 0.0 Plant regulator RWP-RK family protein (.1) Lus10014428 [exp] 89 / 3e-22 AT4G35270 659 / 0.0 Plant regulator RWP-RK family protein (.1) Lus10016018 [exp] 70 / 2e-15 AT1G76350 775 / 0.0 Plant regulator RWP-RK family protein (.1) Lus10012257 [exp] 69 / 4e-15 AT1G20640 785 / 0.0 Plant regulator RWP-RK family protein (.1.2) Lus10001810 [exp] 61 / 2e-12 AT4G24020 319 / 6e-100 NIN like protein 7 (.1) Lus10013224 [exp] 61 / 2e-12 AT1G20640 600 / 0.0 Plant regulator RWP-RK family protein (.1.2) Lus10030744 [exp] 61 / 3e-12 AT1G20640 427 / 1e-138 Plant regulator RWP-RK family protein (.1.2) Lus10003199 [exp] 59 / 2e-11 AT4G24020 953 / 0.0 NIN like protein 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G166932 [exp] 89 / 3e-22 AT4G35270 874 / 0.0 Plant regulator RWP-RK family protein (.1) Potri.004G205500 [exp] 81 / 2e-19 AT4G35270 829 / 0.0 Plant regulator RWP-RK family protein (.1) Potri.009G166400 [exp] 74 / 4e-17 AT4G35270 730 / 0.0 Plant regulator RWP-RK family protein (.1) Potri.002G009700 [exp] 72 / 3e-16 AT1G20640 824 / 0.0 Plant regulator RWP-RK family protein (.1.2) Potri.005G251700 [exp] 70 / 1e-15 AT4G35270 739 / 0.0 Plant regulator RWP-RK family protein (.1) Potri.009G087500 [exp] 66 / 3e-14 AT4G35270 301 / 5e-92 Plant regulator RWP-RK family protein (.1) Potri.001G293300 [exp] 64 / 9e-14 AT4G35270 301 / 7e-92 Plant regulator RWP-RK family protein (.1) Potri.009G166666 [exp] 61 / 3e-12 AT4G35270 702 / 0.0 Plant regulator RWP-RK family protein (.1) Potri.001G087900 [exp] 58 / 2e-11 AT4G24020 991 / 0.0 NIN like protein 7 (.1) Potri.003G143000 [exp] 56 / 7e-11 AT4G24020 994 / 0.0 NIN like protein 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00564 [flax] [poplar] PB1 PB1 domain
Representative CDS sequence Show only first row Show all	>Lus10003318 pacid=23148050 polypeptide=Lus10003318 locus=Lus10003318.g ID=Lus10003318.BGIv1.0 annot-version=v1.0 ATGCGAGAGGTTCTGCATCGGTTCAACATAGACGAAAAGACGTGCAGAGTTGATCTCAAGTACTTGGACGATGATCATGAGTGGGTTCTCTTGACTTGTG ATGCCGATCTCGAGGAATGTAAAGATGTTTGCAGGTCTGAGGAGTGCCATACGATTGAACTCTCGCTGCATCAATCGCAGTTCGCGAGTGTACGAGCCAA AACCGGGCAGCAGTCCGGCACCAATGGACATACGAGTGGTTAG
AA sequence Show only first row Show all	>Lus10003318 pacid=23148050 polypeptide=Lus10003318 locus=Lus10003318.g ID=Lus10003318.BGIv1.0 annot-version=v1.0 MREVLHRFNIDEKTCRVDLKYLDDDHEWVLLTCDADLEECKDVCRSEECHTIELSLHQSQFASVRAKTGQQSGTNGHTSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20640		NLP4	Plant regulator RWP-RK family ...		Lus10003318 [exp]	0	1
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	5.0	0.8790
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	5.3	0.8692
AT3G43810		CAM7	calmodulin 7 (.1)		Lus10022589 [exp]	6.7	0.8238
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10036465 [exp]	7.0	0.8532
AT1G68800	TCP	TCP12, BRC2, TC...	BRANCHED 2, TCP domain protein...		Lus10042962 [exp]	8.7	0.8665
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	10.6	0.8439
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	15.2	0.8570
					Lus10017219 [exp]	15.9	0.8270
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	16.7	0.8244
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	16.9	0.8251

Compare expression of checked genes

Lus10003318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.