Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01435 176 / 3e-58 Expressed protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022634 [exp] 259 / 4e-91 AT3G01435 174 / 8e-58 Expressed protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G001600 [exp] 195 / 1e-65 AT3G01435 169 / 1e-55 Expressed protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10280 [flax] [poplar] Med11 Mediator complex protein
Representative CDS sequence Show only first row Show all	>Lus10003331 pacid=23148036 polypeptide=Lus10003331 locus=Lus10003331.g ID=Lus10003331.BGIv1.0 annot-version=v1.0 ATGGATTCGCCGTCGCAGAACACCTCATTGCACCGCCTTCAGAACGTAGAGAAGACGATTGTCAAGGTTCTGGAGCTAGCTGGAGGAGTGATGGATGAAC TGGCGAATCCTATGGGCCCTAGGAAGGAATTCATCAACAACCATTGTCGTGAATTCATGCAAATGATCAAGGATATCCAATTTACTCTGCGGAACGAGAT CAAGAGCACATGCGAGTACCGTCCTTTCGAGAAGTGTGATTACAGCTCAAGAATATCCAACGAAATCTGCTTCGACAAAATAGAGTATCTGCTTTCCCAT CTGGATGGTATGACCAAAGCTGTCGAACGATACCATGCTGATGCTGCTACTGCTGCCGATGTCCCGTCCCCCATGAGTGAATGA
AA sequence Show only first row Show all	>Lus10003331 pacid=23148036 polypeptide=Lus10003331 locus=Lus10003331.g ID=Lus10003331.BGIv1.0 annot-version=v1.0 MDSPSQNTSLHRLQNVEKTIVKVLELAGGVMDELANPMGPRKEFINNHCREFMQMIKDIQFTLRNEIKSTCEYRPFEKCDYSSRISNEICFDKIEYLLSH LDGMTKAVERYHADAATAADVPSPMSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01435			Expressed protein (.1)		Lus10003331 [exp]	0	1
AT3G53220			Thioredoxin superfamily protei...		Lus10013827 [exp]	1.7	0.8396
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	4.5	0.8409
AT1G10890			unknown protein		Lus10043141 [exp]	5.0	0.8425
AT1G28100			unknown protein		Lus10002573 [exp]	7.5	0.8248
AT2G35736			unknown protein		Lus10028935 [exp]	12.6	0.8328
AT1G01940			Cyclophilin-like peptidyl-prol...		Lus10009237 [exp]	13.5	0.8089
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10043137 [exp]	13.6	0.7392
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10019602 [exp]	15.1	0.8268
AT4G19150			Ankyrin repeat family protein ...		Lus10001048 [exp]	16.0	0.8002
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	16.1	0.7855

Compare expression of checked genes

Lus10003331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.