Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61110 46 / 2e-06 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G15510 44 / 9e-06 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G52880 44 / 1e-05 NAC ATNAM, NAM, ANAC018, NARS2 NAC-REGULATED SEED MORPHOLOGY 2, Arabidopsis NAC domain containing protein 18, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 40 / 0.0004 NAC ANAC032 NAC domain containing protein 32 (.1) AT2G33480 39 / 0.0005 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT3G04070 39 / 0.0005 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G69490 39 / 0.0006 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT4G27410 39 / 0.0006 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT5G13180 39 / 0.0007 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022637 [exp] 153 / 1e-46 ND / Lus10031937 [exp] 94 / 2e-23 AT1G77450 67 / 1e-12 NAC domain containing protein 32 (.1) Lus10033676 [exp] 68 / 8e-14 AT3G10480 72 / 4e-13 NAC domain containing protein 50 (.1.2.3) Lus10008200 [exp] 59 / 4e-11 ND 43 / 6e-05 Lus10004531 [exp] 60 / 6e-11 AT2G24430 50 / 2e-06 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10008240 [exp] 56 / 1e-09 AT1G33060 50 / 1e-06 NAC 014 (.1.2) Lus10033279 [exp] 55 / 3e-09 AT5G62380 61 / 5e-10 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10022965 [exp] 54 / 4e-09 AT2G24430 62 / 1e-10 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10007204 [exp] 54 / 7e-09 ND 43 / 2e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G027900 [exp] 71 / 4e-15 AT2G24430 66 / 8e-12 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.019G063000 [exp] 69 / 1e-14 AT1G79580 56 / 4e-09 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.015G002900 [exp] 66 / 3e-13 AT1G71930 71 / 2e-13 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.001G220500 [exp] 64 / 2e-12 AT1G77450 66 / 4e-12 NAC domain containing protein 32 (.1) Potri.006G028700 [exp] 52 / 2e-08 AT2G24430 65 / 1e-11 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.006G028300 [exp] 50 / 8e-08 AT3G10480 74 / 5e-14 NAC domain containing protein 50 (.1.2.3) Potri.001G256600 [exp] 49 / 4e-07 AT3G04070 190 / 7e-56 NAC domain containing protein 47 (.1.2) Potri.011G046700 [exp] 48 / 5e-07 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.004G038000 [exp] 48 / 6e-07 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.006G129400 [exp] 46 / 2e-06 AT1G61110 247 / 3e-80 NAC domain containing protein 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10003334 pacid=23148055 polypeptide=Lus10003334 locus=Lus10003334.g ID=Lus10003334.BGIv1.0 annot-version=v1.0 ATGAAGTATCATCATCGCTCTCAGCAAAACTTCGCCTTCGGACTCCTCCCCTCCGACGAGGAGCTCGTCGTCGGCTACCTCATCCCGAAGCTCTGCCAAT TGCCTCTCCCATCCTCCGGCCACGTCATCGACTGCGACCTTTACGGCCAATTCGAGCCCTGGGAGATCTGGTCCAAATTCGGCGGCCACGACTACGACGA CGATGGTGAAGAAGGAGAAGAGACAGCCAATGACATGTACTTCTTCACGCCGTTGAAGAACATGGCGGAAACCGGGATGAGATACGAACGCTCCGTCGGA ACTAACGGCGGTACGTGGAATTCGGAGGACGCACGGCGTTTGGGTCAGAGCAGAGACGGCGTTATAACGTGGGAGAAGAAGAGGTTTAGGTATTTAACGA GAAGCTGTACGGAGAAGAAGAGGAAGCGGAAGAATAATGGTGGGCCGACGATGTTGACACGTCAGCCGGAGGGGTAG
AA sequence Show only first row Show all	>Lus10003334 pacid=23148055 polypeptide=Lus10003334 locus=Lus10003334.g ID=Lus10003334.BGIv1.0 annot-version=v1.0 MKYHHRSQQNFAFGLLPSDEELVVGYLIPKLCQLPLPSSGHVIDCDLYGQFEPWEIWSKFGGHDYDDDGEEGEETANDMYFFTPLKNMAETGMRYERSVG TNGGTWNSEDARRLGQSRDGVITWEKKRFRYLTRSCTEKKRKRKNNGGPTMLTRQPEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10003334 [exp]	0	1
AT3G13560			O-Glycosyl hydrolases family 1...		Lus10000842 [exp]	1.0	0.8771
AT1G26140			unknown protein		Lus10034406 [exp]	2.0	0.8406
					Lus10007779 [exp]	3.9	0.8318
AT3G43860		ATGH9A4	glycosyl hydrolase 9A4 (.1)		Lus10009794 [exp]	8.6	0.8512
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10042370 [exp]	9.3	0.8439
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	16.8	0.8115
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10036457 [exp]	18.1	0.8115
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	19.4	0.8115
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	20.6	0.8115
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	21.7	0.8115

Compare expression of checked genes

Lus10003334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.