Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29635 87 / 2e-20 HXXXD-type acyl-transferase family protein (.1) AT3G29680 82 / 1e-18 HXXXD-type acyl-transferase family protein (.1) AT3G29590 80 / 4e-18 AT5MAT HXXXD-type acyl-transferase family protein (.1) AT5G61160 80 / 4e-18 AACT1 anthocyanin 5-aromatic acyltransferase 1 (.1) AT3G29670 77 / 6e-17 PMAT2 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) AT5G39080 73 / 1e-15 HXXXD-type acyl-transferase family protein (.1) AT5G39090 67 / 2e-13 HXXXD-type acyl-transferase family protein (.1) AT5G39050 66 / 5e-13 PMAT1 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) AT1G03940 56 / 7e-10 HXXXD-type acyl-transferase family protein (.1) AT1G03495 56 / 1e-09 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022646 [exp] 189 / 5e-62 AT5G39050 106 / 6e-27 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10035802 [exp] 199 / 8e-62 AT5G39050 276 / 2e-87 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10020721 [exp] 192 / 1e-59 AT5G39050 280 / 2e-89 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10029798 [exp] 172 / 9e-56 AT3G29680 86 / 4e-20 HXXXD-type acyl-transferase family protein (.1) Lus10033599 [exp] 162 / 3e-48 AT3G29635 307 / 1e-99 HXXXD-type acyl-transferase family protein (.1) Lus10021390 [exp] 112 / 9e-30 AT3G29590 283 / 7e-91 HXXXD-type acyl-transferase family protein (.1) Lus10005362 [exp] 106 / 2e-27 AT3G29635 292 / 4e-94 HXXXD-type acyl-transferase family protein (.1) Lus10020514 [exp] 100 / 2e-25 AT3G29590 296 / 9e-96 HXXXD-type acyl-transferase family protein (.1) Lus10029276 [exp] 98 / 3e-24 AT5G39050 314 / 1e-102 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G120700 [exp] 122 / 2e-33 AT5G39050 343 / 1e-113 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103100 [exp] 114 / 2e-30 AT5G39050 366 / 1e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103200 [exp] 114 / 2e-30 AT5G39050 374 / 1e-125 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110700 [exp] 113 / 4e-30 AT5G39050 369 / 1e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103300 [exp] 112 / 7e-30 AT5G39050 352 / 3e-117 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110400 [exp] 112 / 1e-29 AT5G39050 363 / 2e-121 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110640 [exp] 112 / 1e-29 AT5G39050 365 / 2e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G109800 [exp] 110 / 3e-29 AT5G39050 368 / 2e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G109300 [exp] 110 / 4e-29 AT5G39050 365 / 3e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.010G208100 [exp] 109 / 1e-28 AT5G39050 332 / 3e-109 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10003344 pacid=23148043 polypeptide=Lus10003344 locus=Lus10003344.g ID=Lus10003344.BGIv1.0 annot-version=v1.0 ATGGCTTCCACGACGGCGGTCAAAGTCCTCGACGTCGTCAAAGTGACACCGGAGCCGCCGCCGTCAAATCCACTCTCCTTCCGGCTAACCTTATTCAACA CCATGTGGATCGAATTCCCCCATGTCGAGTCCATGTTCCTTTACCGAGTAACCAATCTATCACCGGAATCGTTCAAATCACAACTCCTTCCTAAACTCCG CCGCTCTCTTTCCCTCACTCTCCACCACTTCCTCCCTCTCGCCGGAACCATCACCTGGCTGACTACTTCCGACGTTTCAGATTCCTTCGCCGTCCTCTCG ATCATCCTCTACACCCCGGGAGACGCGATTTCCGTCACAGTGGCTGAGTCGGCCGGCGACTTCGACCACATCGCCGGCGACGGGGCTCGCCTGGCTTCCG ATTCGTTCGCTTACATACCGGAGTTCTCTGTTTCCAGATTGTGTCTTTCCAGATTTCCTAATGTTTGA
AA sequence Show only first row Show all	>Lus10003344 pacid=23148043 polypeptide=Lus10003344 locus=Lus10003344.g ID=Lus10003344.BGIv1.0 annot-version=v1.0 MASTTAVKVLDVVKVTPEPPPSNPLSFRLTLFNTMWIEFPHVESMFLYRVTNLSPESFKSQLLPKLRRSLSLTLHHFLPLAGTITWLTTSDVSDSFAVLS IILYTPGDAISVTVAESAGDFDHIAGDGARLASDSFAYIPEFSVSRLCLSRFPNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29635			HXXXD-type acyl-transferase fa...		Lus10003344 [exp]	0	1
					Lus10042413 [exp]	20.2	0.6557
AT2G19380			RNA recognition motif (RRM)-co...		Lus10020460 [exp]	29.6	0.6623
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017040 [exp]	31.2	0.6456
AT1G24420			HXXXD-type acyl-transferase fa...		Lus10025521 [exp]	37.0	0.6333
AT1G09380			nodulin MtN21 /EamA-like trans...		Lus10001523 [exp]	48.5	0.6561
					Lus10039973 [exp]	52.6	0.6227
					Lus10020988 [exp]	89.3	0.5787
					Lus10024734 [exp]	94.0	0.5920
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10036959 [exp]	115.7	0.6007
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007102 [exp]	142.4	0.6194

Compare expression of checked genes

Lus10003344 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.