Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29590 63 / 7e-13 AT5MAT HXXXD-type acyl-transferase family protein (.1) AT3G29635 54 / 1e-09 HXXXD-type acyl-transferase family protein (.1) AT1G03940 52 / 5e-09 HXXXD-type acyl-transferase family protein (.1) AT1G03495 52 / 5e-09 HXXXD-type acyl-transferase family protein (.1) AT5G39090 49 / 4e-08 HXXXD-type acyl-transferase family protein (.1) AT3G29680 49 / 6e-08 HXXXD-type acyl-transferase family protein (.1) AT5G39050 48 / 1e-07 PMAT1 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) AT3G29690 38 / 0.0003 HXXXD-type acyl-transferase family protein (.1) AT3G29636 38 / 0.0004 transferase-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022647 [exp] 133 / 4e-42 AT3G29590 69 / 6e-15 HXXXD-type acyl-transferase family protein (.1) Lus10020721 [exp] 115 / 1e-31 AT5G39050 280 / 2e-89 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10036582 [exp] 102 / 8e-27 AT3G01090 834 / 0.0 SNF1-RELATED PROTEIN KINASE 1.1, SNF1 kinase homolog 10 (.1.2.3) Lus10035802 [exp] 101 / 2e-26 AT5G39050 276 / 2e-87 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10033599 [exp] 95 / 2e-24 AT3G29635 307 / 1e-99 HXXXD-type acyl-transferase family protein (.1) Lus10041658 [exp] 60 / 8e-12 AT3G29590 298 / 2e-96 HXXXD-type acyl-transferase family protein (.1) Lus10041657 [exp] 57 / 7e-11 AT3G29590 143 / 3e-40 HXXXD-type acyl-transferase family protein (.1) Lus10041655 [exp] 56 / 2e-10 AT3G29590 277 / 3e-88 HXXXD-type acyl-transferase family protein (.1) Lus10041656 [exp] 56 / 3e-10 AT3G29590 242 / 6e-76 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G103100 [exp] 76 / 2e-17 AT5G39050 366 / 1e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.001G455150 [exp] 74 / 2e-17 AT5G39050 191 / 7e-58 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G096200 [exp] 71 / 1e-16 AT5G39050 133 / 7e-37 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G096066 [exp] 71 / 6e-16 AT5G39050 273 / 2e-86 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103200 [exp] 71 / 9e-16 AT5G39050 374 / 1e-125 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103300 [exp] 67 / 2e-14 AT5G39050 352 / 3e-117 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G096425 [exp] 65 / 4e-14 AT5G39050 143 / 2e-40 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.009G019700 [exp] 65 / 9e-14 AT3G29590 304 / 1e-98 HXXXD-type acyl-transferase family protein (.1) Potri.004G096300 [exp] 65 / 1e-13 AT3G29670 311 / 1e-101 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) Potri.004G096132 [exp] 65 / 1e-13 AT3G29670 308 / 2e-100 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10003345 pacid=23148051 polypeptide=Lus10003345 locus=Lus10003345.g ID=Lus10003345.BGIv1.0 annot-version=v1.0 ATGGTGGGAGCGAAGGAGAGGCTGGGTGCTTTTTTGTTAACGAATAGACCGGAGTTTGCGATTGGGGTGGCCAGGACGCGGAGGCTGAAGTTGTACGGCA GTGATTTCGGGTATGAAAAGCCGGCGAAGGTGGAGATCACGTCGACTGCAAAGACGGGATCTGTGTCGATAATGGAGAGTAAAGTACGGAGAGGCGGAGC TGACGTAGGAGTTGTGTTGAAGCAGGATCAGATGGACGTGTTTCGCCCGGCGTTCACCGGAATGGCTGGAAAATGCAACCTCTAG
AA sequence Show only first row Show all	>Lus10003345 pacid=23148051 polypeptide=Lus10003345 locus=Lus10003345.g ID=Lus10003345.BGIv1.0 annot-version=v1.0 MVGAKERLGAFLLTNRPEFAIGVARTRRLKLYGSDFGYEKPAKVEITSTAKTGSVSIMESKVRRGGADVGVVLKQDQMDVFRPAFTGMAGKCNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10003345 [exp]	0	1
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10003585 [exp]	1.0	1.0000
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10013268 [exp]	2.0	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10035280 [exp]	2.4	1.0000
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Lus10005476 [exp]	3.5	0.9848
					Lus10014650 [exp]	3.9	0.9806
					Lus10042250 [exp]	5.1	0.8219
AT5G51490			Plant invertase/pectin methyle...		Lus10027204 [exp]	5.2	0.8969
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10013134 [exp]	5.3	0.9738
					Lus10027457 [exp]	5.5	0.9787
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Lus10002196 [exp]	6.2	0.7562

Compare expression of checked genes

Lus10003345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.