Lus10003347 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G06000 248 / 3e-79 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
AT5G65560 155 / 6e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39710 150 / 2e-41 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G05670 144 / 6e-39 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G09680 139 / 2e-37 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G06710 138 / 8e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G20090 137 / 1e-36 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 133 / 1e-35 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G63230 129 / 2e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12700 133 / 3e-35 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004533 378 / 7e-130 AT2G06000 517 / 4e-180 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
Lus10004615 366 / 4e-125 AT2G06000 531 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
Lus10012068 145 / 3e-39 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027916 145 / 3e-39 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027914 143 / 1e-38 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014245 139 / 2e-37 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10009201 130 / 4e-36 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10022861 133 / 2e-35 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10039056 134 / 3e-35 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G141800 263 / 9e-85 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
Potri.013G034300 143 / 1e-39 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G257300 142 / 9e-39 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G034200 141 / 3e-38 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G242200 140 / 4e-38 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G032600 140 / 7e-38 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G149800 139 / 1e-37 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271400 139 / 2e-37 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G049400 139 / 4e-37 AT1G79540 787 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G014500 139 / 4e-37 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10003347 pacid=23148054 polypeptide=Lus10003347 locus=Lus10003347.g ID=Lus10003347.BGIv1.0 annot-version=v1.0
ATGGTTACTACTTTTAACGGGCTGATCGACTGCTATGGGAAGATCAACGACATGGTTGCAGCAGAAGCCGTTTACGAAAAGATGGACCAGTTCAGTTGCT
CTCCTGATGTGGTTACTTTCACTTCCTTAATCGATGGTTACTGTCGATGTGGACAGGTTAGCCTCGGTATGAAGCTCTGGGATGTGATGAGCGTAAGAAA
CATGATTCCTAATGCGTATACATACGCTGTTCTAATTAACGCTCTTTGCAAGGAGAATAGACTTCACGAGGCCCGCAGACTTTTGACAGAACTGAAGTTT
AGTAACGTTGTAGCAAAGGCATTCATGTACAATCCTGTAATTGATAGGTTTTGCAAAGCTGGCAATGTCGATGAGGCAAATGTCATTGCAAAAGAGATGG
AAGAGACGTTTACCATACTTATTATCGGCCACTGTATGAAAGGTAGACTGTCTGACGCAACCGGTCTTCTCAATAAGATGCTGACCATCGGTTGCTCTCC
TGATAACATTACCATTAGTTCATTGACATCCCGCCTTTTGAAAGCCGGGTTACCTACCGAAGCATTCCGAGCAGCAAATGTCATTGCAAAAGAGATGGAA
GAGAAAAAGTGCGTTCCCGACAAAGTGACGTTTACCATACTTATTATCGGCCACTGTATGAAAGGTAGAATGTCTGACGCAACCGGTCTTCTCAATAAGA
TGCTGACCATCGGTTGCTCTCCTGATAACATTACCATTAGTTCATTGACATCCCGCCTTTTGAAAGCTGGGTTACCTAAACATTGA
AA sequence
>Lus10003347 pacid=23148054 polypeptide=Lus10003347 locus=Lus10003347.g ID=Lus10003347.BGIv1.0 annot-version=v1.0
MVTTFNGLIDCYGKINDMVAAEAVYEKMDQFSCSPDVVTFTSLIDGYCRCGQVSLGMKLWDVMSVRNMIPNAYTYAVLINALCKENRLHEARRLLTELKF
SNVVAKAFMYNPVIDRFCKAGNVDEANVIAKEMEETFTILIIGHCMKGRLSDATGLLNKMLTIGCSPDNITISSLTSRLLKAGLPTEAFRAANVIAKEME
EKKCVPDKVTFTILIIGHCMKGRMSDATGLLNKMLTIGCSPDNITISSLTSRLLKAGLPKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G06000 Pentatricopeptide repeat (PPR)... Lus10003347 0 1
AT5G14880 Potassium transporter family p... Lus10012888 5.3 0.7164
AT1G78880 Ubiquitin-specific protease fa... Lus10030215 70.9 0.6253
AT2G03880 REME1 required for efficiency of mit... Lus10022974 97.6 0.6131
AT4G36440 unknown protein Lus10041785 107.4 0.5858
AT4G02220 zinc finger (MYND type) family... Lus10029718 169.4 0.5850

Lus10003347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.