Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G43610 137 / 9e-39 Spc97 / Spc98 family of spindle pole body (SBP) component (.1) AT5G06680 47 / 3e-07 ATSPC98, SPC98, ATGCP3 ARABIDOPSIS THALIANA GAMMA TUBULIN COMPLEX PROTEIN 3, spindle pole body component 98 (.1) AT5G17410 47 / 5e-07 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2) AT3G53760 43 / 8e-06 ATGCP4 GAMMA-TUBULIN COMPLEX PROTEIN 4 (.1) AT1G80260 43 / 1e-05 EMB1427 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008428 [exp] 203 / 5e-62 AT3G43610 715 / 0.0 Spc97 / Spc98 family of spindle pole body (SBP) component (.1) Lus10028588 [exp] 42 / 3e-05 AT1G80260 942 / 0.0 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1) Lus10018892 [exp] 41 / 4e-05 AT1G80260 919 / 0.0 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G153300 [exp] 153 / 1e-44 AT3G43610 855 / 0.0 Spc97 / Spc98 family of spindle pole body (SBP) component (.1) Potri.010G180700 [exp] 46 / 7e-07 AT5G17410 994 / 0.0 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2) Potri.014G128400 [exp] 45 / 1e-06 AT3G53760 1076 / 0.0 GAMMA-TUBULIN COMPLEX PROTEIN 4 (.1) Potri.016G000100 [exp] 44 / 3e-06 AT1G80260 431 / 3e-137 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0540 [flax] [poplar] GCP PF04130 [flax] [poplar] GCP_C_terminal Gamma tubulin complex component C-terminal
Representative CDS sequence Show only first row Show all	>Lus10003353 pacid=23161701 polypeptide=Lus10003353 locus=Lus10003353.g ID=Lus10003353.BGIv1.0 annot-version=v1.0 ATGGAGTTGAATAGAAAAGTCCCAGAAATTCAAGGTATTCTTGAGTTGTCACTTCAGCGATCGTCTTGTGAAAGAGATCCTAACAAGGATCGTTTATTTG TCTACACCAAAGGGAGCGACTTGATGCCCTCATCGGCAATCGGTGTTAATTCTTTCGACTTTCTTGGTTTGGGTTATAGAGTGACATGGCCAATCAGTAT CATTTTGACTCCAACAGCCCTGAAAATGTATGCTCAGATTTTCAGTTTTCTGATGAAAGTGAAGCTCGCTGTTTCATCTTTGACAGACATATGGTGCTCT TTGAAGGTAGTCATGCATTAG
AA sequence Show only first row Show all	>Lus10003353 pacid=23161701 polypeptide=Lus10003353 locus=Lus10003353.g ID=Lus10003353.BGIv1.0 annot-version=v1.0 MELNRKVPEIQGILELSLQRSSCERDPNKDRLFVYTKGSDLMPSSAIGVNSFDFLGLGYRVTWPISIILTPTALKMYAQIFSFLMKVKLAVSSLTDIWCS LKVVMH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G43610			Spc97 / Spc98 family of spindl...		Lus10003353 [exp]	0	1
AT2G45280		ATRAD51C	RAS associated with diabetes p...		Lus10000790 [exp]	4.2	0.7945
AT1G03687			DTW domain-containing protein ...		Lus10018590 [exp]	4.9	0.7838
AT5G51140			Pseudouridine synthase family ...		Lus10016743 [exp]	7.7	0.7805
AT3G13860		HSP60-3A	heat shock protein 60-3A (.1)		Lus10003791 [exp]	13.3	0.7524
AT5G41480		EMB9, ATDFA, GL...	GLOBULAR ARREST1, EMBRYO DEFEC...		Lus10014939 [exp]	14.1	0.7993
AT4G03090			sequence-specific DNA binding;...		Lus10006937 [exp]	23.0	0.7807
AT3G09890			Ankyrin repeat family protein ...		Lus10021508 [exp]	25.0	0.7118
					Lus10006038 [exp]	28.4	0.6836
AT5G04520			Protein of unknown function DU...		Lus10017450 [exp]	33.9	0.7152
AT1G09020		ATSNF4, SNF4	homolog of yeast sucrose nonfe...		Lus10037503 [exp]	34.6	0.7548

Compare expression of checked genes

Lus10003353 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.