Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28060 150 / 2e-48 5'-AMP-activated protein kinase beta-2 subunit protein (.1) AT4G16360 112 / 6e-32 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) AT5G21170 100 / 5e-27 AKINBETA1 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008427 [exp] 216 / 1e-74 AT2G28060 157 / 6e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Lus10038783 [exp] 105 / 9e-29 AT4G16360 395 / 1e-139 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10039076 [exp] 104 / 3e-28 AT4G16360 392 / 2e-138 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10037424 [exp] 96 / 3e-25 AT5G21170 305 / 2e-104 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Lus10041287 [exp] 96 / 5e-25 AT5G21170 295 / 6e-100 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Lus10012343 [exp] 83 / 7e-21 AT4G16360 220 / 1e-72 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10006390 [exp] 80 / 4e-19 AT4G16360 222 / 3e-72 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G008700 [exp] 186 / 1e-62 AT2G28060 158 / 2e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Potri.004G213600 [exp] 179 / 5e-60 AT2G28060 156 / 8e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Potri.016G006400 [exp] 108 / 3e-30 AT4G16360 415 / 5e-148 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Potri.006G005800 [exp] 108 / 8e-30 AT4G16360 408 / 3e-145 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Potri.001G220800 [exp] 100 / 7e-27 AT5G21170 316 / 1e-108 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Potri.009G021600 [exp] 97 / 2e-25 AT5G21170 319 / 1e-109 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Potri.014G167400 [exp] 74 / 8e-17 AT4G16360 206 / 2e-65 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04739 [flax] [poplar] AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Representative CDS sequence Show only first row Show all	>Lus10003355 pacid=23161708 polypeptide=Lus10003355 locus=Lus10003355.g ID=Lus10003355.BGIv1.0 annot-version=v1.0 ATGCAGGAAGAACCAACCGTAGCAGGATTCGAAGTTCCCAACTCTCCTGATTCAAGCTACACCAATGCTTACCCTGGAACGGAAGATGAGGCGAGGGACC CTCCTGCAGTCCCTCCACACCTGCAACAGACTTTACTCGGCTACCCGGCAAGTGCAGATACTTCGGAGTCGATCCCACCTCCACAGGATGTTGTTCTGAA CCATCTCTATATCGAGAATCGGGAGCCACCACGTTCAGTGGTGGCGCTCGGGTTCACTCATCGCTTCCGAGCAAAGTATGTCACAGTTGTGCTATACAAA CCTGTTCAGAGGAGGGGGAGTACCAGCACATAG
AA sequence Show only first row Show all	>Lus10003355 pacid=23161708 polypeptide=Lus10003355 locus=Lus10003355.g ID=Lus10003355.BGIv1.0 annot-version=v1.0 MQEEPTVAGFEVPNSPDSSYTNAYPGTEDEARDPPAVPPHLQQTLLGYPASADTSESIPPPQDVVLNHLYIENREPPRSVVALGFTHRFRAKYVTVVLYK PVQRRGSTST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28060			5'-AMP-activated protein kinas...		Lus10003355 [exp]	0	1
					Lus10003603 [exp]	14.1	0.8732
AT2G06210		VIP6, ELF8	VERNALIZATION INDEPENDENCE 6, ...		Lus10000472 [exp]	22.4	0.8423
AT2G39445			Phosphatidylinositol N-acetylg...		Lus10010489 [exp]	24.1	0.8630
AT3G59990		MAP2B	methionine aminopeptidase 2B (...		Lus10005292 [exp]	30.6	0.8455
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Lus10028823 [exp]	34.1	0.8409
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Lus10002565 [exp]	40.2	0.8588
AT5G37370		ATSRL1	PRP38 family protein (.1.2.3.4...		Lus10031361 [exp]	41.6	0.8465
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Lus10019328 [exp]	42.1	0.8582
AT3G52190		AtPHF1, PHF1	phosphate transporter traffic ...		Lus10037923 [exp]	47.8	0.8515
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10014627 [exp]	53.0	0.8397

Compare expression of checked genes

Lus10003355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.