Lus10003357 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52860 131 / 6e-40 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008425 191 / 9e-64 AT3G52860 179 / 1e-58 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G127900 154 / 4e-49 AT3G52860 142 / 5e-44 unknown protein
PFAM info
Representative CDS sequence
>Lus10003357 pacid=23161704 polypeptide=Lus10003357 locus=Lus10003357.g ID=Lus10003357.BGIv1.0 annot-version=v1.0
ATGGCTGAGAGGCAAGCTCTGGATCAACCACAGCAGCAGCAGCAAGAGCTACAACCACCATCTCAGCAGAATCCCGAAGGAGAAGACATGGTAGCTTGTG
TAATGGCGTTAGAGGCTGCTTTGCTTCCATGCTTGCCCGCCAGGGAGCTCCAAGCCATCGACCGGTGTCCCCACCCATCTCACCAGATTGATGTGGAGAG
GCATGCAAGGGATTTCATGGAGGCTGCTAAGAAGCTTCAACTGTATTTCATCGGACTCCAACACAAAGACCAGCCTACCGCAGCCGGAAAGCTTAGAAAG
AAGATTGCTGAAATGGAGGAAGAGTTGAAGACGAAAGGCGAGCTTATCAAGAAGCAAGAGAGACTTATCCAGGGGTGGCGAGAAGATCTCAAAGAGCAGT
TGGAGAAGCATAAGATTGAACTGGAGACAGTATGA
AA sequence
>Lus10003357 pacid=23161704 polypeptide=Lus10003357 locus=Lus10003357.g ID=Lus10003357.BGIv1.0 annot-version=v1.0
MAERQALDQPQQQQQELQPPSQQNPEGEDMVACVMALEAALLPCLPARELQAIDRCPHPSHQIDVERHARDFMEAAKKLQLYFIGLQHKDQPTAAGKLRK
KIAEMEEELKTKGELIKKQERLIQGWREDLKEQLEKHKIELETV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52860 unknown protein Lus10003357 0 1
AT4G08690 Sec14p-like phosphatidylinosit... Lus10033464 5.2 0.8804
AT1G03330 Small nuclear ribonucleoprotei... Lus10042686 8.9 0.8726
AT5G43430 ETFBETA electron transfer flavoprotein... Lus10022185 18.7 0.8648
AT4G10970 unknown protein Lus10032393 20.1 0.8338
AT2G26990 COP12, ATCSN2, ... FUSCA 12, CONSTITUTIVE PHOTOMO... Lus10037417 23.8 0.8570
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Lus10016998 24.4 0.8680
AT1G20670 DNA-binding bromodomain-contai... Lus10001391 24.8 0.8535
AT2G34470 PSKF109, UREG urease accessory protein G (.1... Lus10004922 24.9 0.8665
AT1G27900 RNA helicase family protein (.... Lus10015812 25.6 0.8624
AT4G05440 EDA35 embryo sac development arrest ... Lus10027954 30.9 0.8575

Lus10003357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.