Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14620 59 / 1e-10 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT5G24910 50 / 1e-07 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) AT3G14610 49 / 2e-07 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14640 49 / 4e-07 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14650 49 / 4e-07 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14630 48 / 4e-07 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14660 47 / 2e-06 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14680 46 / 2e-06 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14690 45 / 7e-06 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT1G17060 45 / 7e-06 SHK1, CHI2, SOB7, CYP72C1 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008423 [exp] 106 / 3e-27 AT5G24910 462 / 9e-159 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Lus10036816 [exp] 56 / 2e-09 AT3G14620 339 / 8e-111 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10005788 [exp] 56 / 2e-09 AT5G64790 565 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10019354 [exp] 55 / 2e-09 AT3G14640 281 / 2e-88 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) Lus10019175 [exp] 55 / 3e-09 AT3G14620 318 / 1e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10019176 [exp] 55 / 3e-09 AT3G14620 342 / 8e-112 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10026084 [exp] 54 / 6e-09 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036817 [exp] 53 / 1e-08 AT2G26710 382 / 3e-121 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10028119 [exp] 53 / 2e-08 AT1G30130 368 / 2e-121 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139400 [exp] 63 / 3e-12 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G116300 [exp] 61 / 2e-11 AT5G24910 376 / 3e-125 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.010G139500 [exp] 54 / 5e-09 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.010G139200 [exp] 54 / 8e-09 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139300 [exp] 53 / 1e-08 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 52 / 2e-08 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.013G160800 [exp] 49 / 2e-07 AT5G24910 468 / 6e-161 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026200 [exp] 49 / 3e-07 AT5G24910 488 / 8e-169 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026300 [exp] 49 / 3e-07 AT5G24910 486 / 5e-168 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.019G071200 [exp] 47 / 9e-07 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10003359 pacid=23161702 polypeptide=Lus10003359 locus=Lus10003359.g ID=Lus10003359.BGIv1.0 annot-version=v1.0 ATGTCAGCTTACAATGGTGATCCAAGAGGCACTGTGGCTATACCCTCCGGGCGTGTTCGTGGTGAGGGAAGTACTTCAAGACATCAAGTTCAAGAACATA ACGATTCTGAAAGGAATAAAATTCAGGTTCCGATCTCGATCGTACAGCGAAATCCCGAGTTGTGGGGGCCAGATGCACACCTCTTTAACCACGAAAGGTT CGCGGATGGAATACTTGGGGCTACTAGCGGCGGAAAGAGCAATGAGCAGGCTTACATTCCATTCGGAGTTGGTGCGCAACTTCTCGATCTCACCATCATA CGATCATTCCCCGGCGTTCGCGCTGGTCGTGCAGCCAGGGCATGGGGTTCGCCTCCTCATAAAGAGAGTTCCTTCATGATTAAGGGAATGACCCTGGGCG GTGGTATAGAATCAAACCTTGCAACTTGGCTGCTTGTGAATGTGGTAAAGAACTGA
AA sequence Show only first row Show all	>Lus10003359 pacid=23161702 polypeptide=Lus10003359 locus=Lus10003359.g ID=Lus10003359.BGIv1.0 annot-version=v1.0 MSAYNGDPRGTVAIPSGRVRGEGSTSRHQVQEHNDSERNKIQVPISIVQRNPELWGPDAHLFNHERFADGILGATSGGKSNEQAYIPFGVGAQLLDLTII RSFPGVRAGRAARAWGSPPHKESSFMIKGMTLGGGIESNLATWLLVNVVKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14620		CYP72A8	"cytochrome P450, family 72, s...		Lus10003359 [exp]	0	1

Compare expression of checked genes

Lus10003359 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.