Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24910 108 / 4e-28 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) AT5G24900 106 / 1e-27 ELA2, CYP714A2 EUI-like p450 A2, cytochrome P450, family 714, subfamily A, polypeptide 2 (.1) AT5G38450 62 / 8e-12 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) AT2G46950 60 / 5e-11 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT5G52400 59 / 8e-11 CYP715A1 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) AT1G67110 57 / 4e-10 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2", cytochrome P450, family 735, subfamily A, polypeptide 2 (.1) AT2G26710 57 / 6e-10 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14680 53 / 1e-08 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14660 52 / 2e-08 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14620 50 / 8e-08 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008423 [exp] 227 / 6e-73 AT5G24910 462 / 9e-159 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Lus10027480 [exp] 79 / 8e-18 AT5G52400 424 / 6e-146 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) Lus10039234 [exp] 77 / 5e-17 AT5G52400 653 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) Lus10033555 [exp] 67 / 2e-13 AT5G38450 694 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Lus10017595 [exp] 66 / 4e-13 AT5G38450 697 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Lus10026085 [exp] 64 / 2e-12 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10004633 [exp] 60 / 5e-11 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017775 [exp] 57 / 7e-10 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10005788 [exp] 56 / 1e-09 AT5G64790 565 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G026200 [exp] 142 / 1e-40 AT5G24910 488 / 8e-169 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026300 [exp] 141 / 2e-40 AT5G24910 486 / 5e-168 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.013G160800 [exp] 138 / 4e-39 AT5G24910 468 / 6e-161 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.019G064200 [exp] 128 / 2e-35 AT5G24910 652 / 0.0 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.010G116300 [exp] 92 / 1e-22 AT5G24910 376 / 3e-125 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.012G142000 [exp] 80 / 5e-18 AT5G52400 622 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) Potri.015G145100 [exp] 75 / 2e-16 AT5G52400 646 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) Potri.004G100400 [exp] 71 / 9e-15 AT5G38450 734 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Potri.017G114200 [exp] 68 / 6e-14 AT5G38450 724 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Potri.002G134500 [exp] 63 / 3e-12 AT1G75130 540 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10003360 pacid=23161710 polypeptide=Lus10003360 locus=Lus10003360.g ID=Lus10003360.BGIv1.0 annot-version=v1.0 ATGACTCGTATGTGTTTGTCAAGGTTCTTTGTTTTGGTTGAGCTGTTTATCATGATTTTCGGAGGGCCAACATTTGTATACTCGACTGGGAACATACAGT TACTGTGCACAGTTGATGCTAACATGGTGAAGGAGATCAGCCTTTCAACTTCATTAAGCTTGGGGAGACCTTCTTACCTCTCGAGGGATTTCGGCCCTCT CTTTGGCAATAGCATCATCGCCTCTAGTGGCCCTGTTTGGTCTCATCAGCGAAAAATCATCGCTCCTCAGTTCTACCCTGACACGGTTAAGAGCATGGTG AGCCTTATGGTGGAGTCAACCACTTCAGGAAAGGTTACTGATATAAACATAGAACATGACATAAGAAGCTTATTTGTTGATATAATCTCCAGAGCTTGCT TTGGTAGCAACTACAAGGCTGGGGAACACATAATTCTCGAAGCTTAA
AA sequence Show only first row Show all	>Lus10003360 pacid=23161710 polypeptide=Lus10003360 locus=Lus10003360.g ID=Lus10003360.BGIv1.0 annot-version=v1.0 MTRMCLSRFFVLVELFIMIFGGPTFVYSTGNIQLLCTVDANMVKEISLSTSLSLGRPSYLSRDFGPLFGNSIIASSGPVWSHQRKIIAPQFYPDTVKSMV SLMVESTTSGKVTDINIEHDIRSLFVDIISRACFGSNYKAGEHIILEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24910		ELA1, CYP714A1	EUI-like p450 A1, cytochrome P...		Lus10003360 [exp]	0	1

Compare expression of checked genes

Lus10003360 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.